Telmisartan/Hydrochlorothiazide Glenmark 80 mg/12,5 mg Tablett

Sverige - svenska - Läkemedelsverket (Medical Products Agency)

Köp det nu

Bipacksedel Bipacksedel (PIL)

02-02-2015

Produktens egenskaper Produktens egenskaper (SPC)

02-02-2015

Aktiva substanser:
hydroklortiazid; telmisartan
Tillgänglig från:
Glenmark Pharmaceuticals Europe Limited
ATC-kod:
C09DA07
INN (International namn):
hydrochlorothiazide; telmisartan
Dos:
80 mg/12,5 mg
Läkemedelsform:
Tablett
Sammansättning:
laktosmonohydrat Hjälpämne; hydroklortiazid 12,5 mg Aktiv substans; telmisartan 80 mg Aktiv substans; mannitol Hjälpämne
Klass:
Apotek
Receptbelagda typ:
Receptbelagt
Terapiområde:
Telmisartan och diuretika
Bemyndigande status:
Avregistrerad
Godkännandenummer:
49100
Tillstånd datum:
2014-04-24

Läs hela dokumentet

Läkemedelsverket2015-02-02

Bipacksedel:Informationtillanvändaren

Telmisartan/HydrochlorothiazideGlenmark80mg/12,5mgtabletter

Telmisartan/hydroklortiazid

Läsnogaigenomdennabipacksedelinnandubörjartadettaläkemedel.Deninnehållerinformationsom

ärviktigfördig.

Sparadennainformation,dukanbehövaläsadenigen.

Omduharytterligarefrågor,vänddigtillläkareellerapotekspersonal.

Dettaläkemedelharordineratsenbartåtdig.Gedetintetillandra.Detkanskadadem,ävenomde

uppvisarsjukdomsteckensomliknardina.

Omdufårbiverkningar,talamedläkareellerapotekspersonal.Dettagälleräveneventuellabiverkningar

somintenämnsidennainformation.Seavsnitt4.

Idennabipacksedelfinnsinformationomföljande:

VadTelmisartan/HydrochlorothiazideGlenmarkärochvaddetanvändsför

VaddubehövervetainnandutarTelmisartan/HydrochlorothiazideGlenmark

HurdutarTelmisartan/HydrochlorothiazideGlenmark

Eventuellabiverkningar

HurTelmisartan/HydrochlorothiazideGlenmarkskaförvaras

Förpackningensinnehållochövrigaupplysningar

1. VadTelmisartan/HydrochlorothiazideGlenmarkärochvaddetanvändsför

Telmisartan/HydrochlorothiazideGlenmarkärenkombinationavtvåaktivasubstanser,telmisartanoch

hydroklortiazidientablett.Bådadessasubstanserhjälpertillatthållahögtblodtryckunderkontroll.

TelmisartantillhörengruppläkemedelsomkallasangiotensinII-antagonister.Angiotensin-IIärett

kroppsegetämnesomfårblodkärlenattdrassammanvilketledertillattdittblodtryckstiger.

TelmisartanblockerardenhäreffektenavangiotensinII,vilketledertillattblodkärlenvidgasoch

blodtrycketsänks.

Hydroklortiazidhörtillengruppläkemedelsomkallastiaziddiuretikasomorsakarökad

urinutsöndring,vilketävenledertillensänkningavdittblodtryck.

Högtblodtrycksomintebehandlaskanorsakakärlskadorifleraorgan,somivissafallkanledatill

hjärtattack,hjärtsvikt,njursvikt,strokeellerblindhet.Oftastgerhögtblodtryckingasymptominnanskadorna

uppträder.Detärdärförviktigtattregelbundetmätablodtrycketförattbekräftaattdetärnormalt.

Telmisartan/HydrochlorothiazideGlenmarkanvändsförattbehandlahögtblodtryck(essentiellhypertoni)

hosvuxnaivilkablodtrycketintekanhållastillräckligtunderkontrollmedanvändningavenbarttelmisartan.

TelmisartanochhydroklortiazidsomfinnsiTelmisartan/HydrochlorothiazideGlenmarkkanocksåvara

godkändförattbehandlaandrasjukdomarsomintenämnsidennaproduktinformation.Frågaläkare,apotek

ellerannanhälsovårdspersonalomduharytterligarefrågorochföljalltidderasinstruktion.

2. VaddubehövervetainnandutarTelmisartan/HydrochlorothiazideGlenmark

TainteTelmisartan/HydrochlorothiazideGlenmark:

omduärallergiskmottelmisartanellermotnågotavövrigainnehållsämnenidettaläkemedel(angesi

avsnitt6).

omduärallergiskmothydroklortiazidellermotnågotannatsulfonamidläkemedel.

underdesista6månadernaavgraviditeten.(Äventidigareundergraviditetenärdetbraattundvika

dettaläkemedel,seGraviditetochamning.)

omduharsvåraleverproblemsåsomgallstasellergallvägsobstruktion(problemmedavflödeavgalla

frångallblåsan)ellernågonannansvårleversjukdom.

Läkemedelsverket2015-02-02

omduharensvårnjursjukdom.

omdinläkarefastställerattduharlågakaliumnivåerellerhögakalciumnivåeriblodetsominte

förbättrasmedbehandling.

omduhardiabetesellernedsattnjurfunktionochdubehandlasmedettblodtryckssänkandeläkemedel

sominnehålleraliskiren..

Taintedettaläkemedelochtalaomfördinläkareellerapotekspersonalinnandutardettaläkemedelomnågot

avovanståendegällerdig.

Varningarochförsiktighet

Talameddinläkareomduharellerharhaftnågotavföljandetillstånd

ellersjukdomar:

Lågtblodtryck(hypotoni)somgärnauppståromduäruttorkad(kraftigförlustavkroppsvätska)eller

omduharsaltbristpågrundavdiuretikabehandling(vätskedrivandebehandling),saltfattigdiet,

diarré,kräkningarellerhemodialys.

Njursjukdomellernjurtransplantation.

Njurartärstenos(förträngningavblodkärlenienellerbådanjurarna).

Leversjukdom.

Hjärtproblem.

Diabetes.

Gikt.

Förhöjdaaldosteronhalter(vattenochsaltansamlingikroppentillsammansmedobalansavolika

mineraleriblodet).

Systemisklupuserythematosus(ävenkallad”lupus”eller”SLE”)ensjukdomdärkroppens

immunsystemattackerarkroppen.

Denaktivasubstansenhydroklortiazidkanorsakaenovanligreaktionsomorsakarförsämradsynoch

ögonsmärta.Dettakanvarasymtompåettökattryckidittöga,ochkaninträffainomtimmartill

veckorefterattdutagitTelmisartan/HydrochlorothiazideGlenmark.Detkanledatillenpermanent

synnedsättningomtillståndetintebehandlas.

TalameddinläkareinnandutarTelmisartan/HydrochlorothiazideGlenmark:

omdutarnågotavföljandeläkemedelsomanvändsförattbehandlahögtblodtryck:

-enACE-hämmare(tillexempelenalapril,lisinopril,ramipril),särskiltomduhardiabetesrelaterade

njurproblem.

-aliskiren.

Dinläkarekanbehövakontrolleranjurfunktion,blodtryckochmängdenelektrolyter(t.ex.kalium)i

blodetmedjämnamellanrum.Seäveninformationunderrubriken“Användinte

Telmisartan/HydrochlorothiazideGlenmark”.

omdutardigoxin.

Dumåstetalaomfördinläkareomdutrorattduär(ellerkanbli)gravid.Telmisartan/hydroklortiazid

rekommenderasinteibörjanavgraviditetenochfårinteanvändasunderde6sistamånadernaavgraviditeten,

eftersomdetkanorsakaallvarligskadapådittbarnomdetanvändsidetskedet(seGraviditetochamning).

Hydroklortiazidkanorsakamuntorrhet,svaghet,sömnighet,dåsighet,rastlöshet,muskelsmärtaellerkramper,

illamående(sjukdomskänsla),kräkningar,tröttamuskler,ochenonormaltsnabbpuls(snabbareän100slag

perminut).Hydroklortiazidkanocksåorsakaförsämradsynochögonsmärta(möjligateckenpåen

ögonsjukdomsomkallasakutvinkelglaukom).Omduupplevernågotavdessasymtomskadutalameddin

läkare.

Duskaocksåtalaomfördinläkareomduuppleveratthudenärmerkänsligförsolljus,medsymtomsom

solbränna(somrödhet,klåda,svullnad,blåsor)somutvecklassnabbareännormalt.

Omduskaopereras,skadutalaomfördinläkareattduanvänderdettaläkemedel.

Dessatabletterkanvaramindreeffektivapåattsänkablodtryckethossvartapatienter.

Läkemedelsverket2015-02-02

Barnochungdomar

Dettaläkemedelrekommenderasintevidbehandlingavbarnochungdomarupptill18årsålder.

AndraläkemedelochTelmisartan/HydrochlorothiazideGlenmark:

Talaomfördinläkareellerapotekspersonalomdutar,nyligenhartagitellerkantänkastaandraläkemedel.

Dinläkarekanbehövaändradosenpådeandraläkemedlenellervidtaandraåtgärder.Ivissafallkandu

behövaslutatanågotavläkemedlen.Dettagällersärskiltdeläkemedellistadenedanomdetassamtidigtmed

telmisartan/hydroklorotiazid:

Litiumhaltigaläkemedelförbehandlingavvissatyperavdepression.

Läkemedelförknippademedlågtkaliumvärdeiblodet(hypokalemi)såsomdiuretika(vätskedrivande

läkemedel),laxermedel(t.ex.ricinolja),kortikosteroider(t.ex.prednison),ACTH(etthormon),

amfotericin(ettsvampdödandemedel),carbenoxolon(användsvidbehandlingavmunsår),penicillin-

G-natrium(ettantibiotikum),salicylsyraochderivat.

Kaliumsparandediuretika,kaliumtillskott,saltersättningsmedelsominnehållerkalium,ACE-hämmare

somkanhöjakaliumnivåernaiblodet.

Hjärtmediciner(t.ex.digoxin)ellerläkemedelsomkontrollerardinhjärtrytm(t.ex.kinidin,

disopyramid).

Läkemedelsomanvändsvidpsykiskasjukdomar(t.ex.tioridazin,klorpromazin,levomepromazin).

Andraläkemedelsomanvändsförattbehandlahögtblodtryck

Steroider

Smärtstillandemediciner

Läkemedelförattbehandlacancer,giktellerartrit

VitaminD-tillskott.

OmdutarenACE-hämmareelleraliskiren(seäveninformationunderrubrikerna“Användinte

Telmisartan/HydrochlorothiazideGlenmark”och”Varningarochförsiktighet”).

Digoxin.

Telmisartan/HydrochlorothiazideGlenmarkkanökadenblodtryckssänkandeeffektenavandraläkemedeloch

dubörrådgörameddinläkareomdubehöverjusteradosenavdinaandraläkemedelnärdutar

Telmisartan/HydrochlorothiazideGlenmark

EffektenavTelmisartan/HydrochlorothiazideGlenmarkkanminskasnärdutarNSAID(icke-steroida

antiinflammatoriskaläkemedel,t.ex.acetylsalicylsyraelleribuprofen).

Graviditet,amningochfertilitet

Graviditet

Dumåstetalaomfördinläkareomdutrorattduär(ellerkanbli)gravid.Vanligtvisföreslårdinläkareatt

duskaslutatadettaläkemedelföregraviditetellersåsnartduvetattduärgravidochiställetrekommendera

digettannatläkemedel.Dessatabletterrekommenderasinteibörjanavgraviditetenochfårintetasunderde6

sistamånadernaavgraviditeten,eftersomdetkanorsakaallvarligskadapådittbarnomdetanvändsunderde

6sistamånaderna.

Amning

Talaomfördinläkareomduammarellertänkerbörjaamma.Dessatabletterrekommenderasintevidamning

ochdinläkarekanväljaenannanbehandlingtilldigomduvillammadittbarn.

Körförmågaochanvändningavmaskiner

Vissapersonerkännersigyraellertröttanärdehartagittelmisartan/hydroklorotiazid.Omdukännerdigyr

ellertröttskaduinteframförafordonelleranvändamaskiner.

Läkemedelsverket2015-02-02

Duärsjälvansvarigförattbedömaomduärikonditionattframföramotorfordonellerutföraarbetesom

kräverskärptuppmärksamhet.Enavfaktorernasomkanpåverkadinförmågaidessaavseendenär

användningavläkemedelpågrundavderaseffekteroch/ellerbiverkningar.Beskrivningavdessa effekteroch

biverkningarfinnsiandraavsnitt.Läsdärförallinformationidennabipacksedelförvägledning.Diskutera

medläkareellerapotekspersonalomduärosäker.

Telmisartan/HydrochlorothiazideGlenmarkinnehållermjölksocker(laktos)

Omduintetålvissasockerarter,bördurådfrågadinläkareinnanduanvänderdettaläkemedel.

3. HurdutarTelmisartan/HydrochlorothiazideGlenmark

Användalltiddettaläkemedelexaktenligtläkarensellerapotekspersonalensanvisningar.Rådfrågadinläkare

ellerapotekspersonalomduärosäker.

Dosering

Denrekommenderadedosenärentablettperdag.

Försökatttatablettenvidsammatidpunktvarjedag.

Dukantadessatablettermedellerutanföda.Tabletternaskasväljasnedmedlitevattenellernågonannan

alkoholfridryck.

Detärviktigtattfortsättatatablettervarjedagtillsläkarengerannatbesked.

Omdinleverintefungerarordentligtbörnormaldoseninteöverstiga40mg/12,5mgengångdagligen.

OmduhartagitförstormängdavTelmisartan/HydrochlorothiazideGlenmark

Omdufåttidigförstormängdläkemedelelleromt.ex.ettbarnfåttisigläkemedletavmisstagkontakta

läkare,sjukhusellerGiftinformationscentralen(tel.112)förbedömningavriskensamtrådgivning.

OmduharglömtatttaTelmisartan/HydrochlorothiazideGlenmark

Bliinteoroligomduglömmeratttaendos.Tadosensåsnartdukommerihågdetochfortsättsedansom

förut.Omduglömmermedicinenendagskadutadenvanligadosennästadag.Taintedubbeldosföratt

kompenseraförglömddos.

Omduharytterligarefrågoromdettaläkemedelkontaktaläkareellerapotekspersonal.

4. Eventuellabiverkningar

Liksomallaläkemedelkandettaläkemedelorsakabiverkningar,menallaanvändarebehöverintefådem.

Vissabiverkningarkanvaraallvarligaochkrävaomedelbarmedicinskbehandling:

Duskaomedelbartuppsökaläkareomdutrorattduharblodförgiftning(sepsis).

Dettaärensvårinfektionmedinflammatoriskareaktionerihelakroppen,hastigsvullnadavhudoch

slemhinnor(angioödem).Dennabiverkningärsällsynt(kanförekommahosupptill1av1000användare)

menextremtallvarligochpatienterskaslutatamedicinenochomedelbartuppsökaläkare.Omdeninte

behandlaskandenvaradödlig.

EventuellabiverkningaravTelmisartan/HydrochlorothiazideGlenmark:

Vanligabiverkningar(kanförekommahosupptill1av10användare):

Yrsel

Mindrevanligabiverkningar(kanförekommahosupptill1av100användare):

Minskadekaliumvärden

Ångest,svimning(synkope)

Upplevelseavdomningar,stickningar(parastesier)

Läkemedelsverket2015-02-02

Svindel(vertigo)

Snabbhjärtrytm(takykardi),hjärtrytmrubbningar

Lågtblodtryck,plötsligtblodtrycksfallnärdureserdigupp

Andningssvårigheter(dyspné)

Diarré,flatulens(gaser)

Muntorrhet

Ryggsmärta,muskelspasmer,muskelvärk,bröstsmärta

Erektildysfunktion(oförmågaattfåellerbibehållaerektion)

Ökadurinsyranivåiblodet.

Sällsyntabiverkningar(kanförekommahosupptill1av1000användare):

Inflammationilungorna(bronkit)

Aktiveringellerförsämringavsystemisklupuserythematosus(ensjukdomdärkroppensimmunförsvar

angriperdenegnakroppenvilketorsakarledsmärta,hudutslagochfeber)

Halsont,inflammeradebihålor

Nedstämdhet(depression)

Sömnsvårigheter(insomnia)

Nedsattsyn

Andningssvårigheter

Magsmärta,förstoppning,väderspänning(dyspepsi),illamående

Inflammationimagen(gastrit)

Avvikandeleverfunktion(japanskapatienterlöperstörreriskattfådennabiverkning)

Hastigsvullnadavhudenochslemhinnorvilketävenkanledatilldöden(angioödemävenmeddödlig

utgång)

Rodnadavhuden(erytem)

Allergiskareaktionersomklådaellerutslag

Ökadsvettning

Nässelutslag(urtikaria)

Ledvärk(artralgi)ochsmärtaiarmarochben

Muskelkramper

Influensaliksjukdom

Smärta

Ökadenivåeravurinsyraiblodet

Låganivåeravnatriumiblodet

Ökadenivåeravkreatinin,leverenzymerellerkreatinfosfokinasiblodet.

Biverkningarsomrapporteratsförenavdeenskildakomponenterna,kanvaraenmöjligbiverkningmed

Telmisartan/HydrochlorothiazideGlenmark,ävenomdeinteobserveratsikliniskastudiermeddetta

läkemedel.

Eventuellabiverkningarmedenbarttelmisartan:

Hospatientersomenbartanvändertelmisartanhardessutomföljandebiverkningarrapporterats:

Mindrevanligabiverkningar(kanförekommahosupptill1av100användare):

Övreluftvägsinfektion(tillexempelhalsont,inflammeradebihålor,vanligförkylning)

Urinvägsinfektioner

Bristpårödablodkroppar(anemi),högakaliumnivåeriblodet

Långsamhjärtfrekvens(bradykardi)

Nedsattnjurfunktion(inklusiveakutnjursvikt)

Svaghet

Hosta.

Läkemedelsverket2015-02-02

Sällsyntabiverkningar(kanförekommahosupptill1av1000användare):

Sepsis*(somoftakallas”blodförgiftning”ärensvårinfektionmedinflammatoriskareaktionerihela

kroppensomkanledatilldöden),lågtantalblodplättar(trombocytopeni),ökningavvissavita

blodkroppar(eosinofili)

Allvarligaallergiskareaktioner(tillexempelöverkänslighet,anafylaktiskreaktion,läkemedelsutslag)

Lågblodsockerhalt(hospatientermeddiabetes),oroligmage,eksem(enhudsjukdom)

Ledvärk(artros)

Seninflammation

Minskadehemoglobinnivåer(ettproteiniblodet)

Sömnighet.

Mycketsällsyntabiverkningar(kanförekommahosupptill1av10000användare):

Progressivärrbildningilungvävnad(interstitielllungsjukdom)**

*Dessabiverkningarkanvaraentillfällighetellerhasambandmedenmekanismsomförnärvarandeinteär

känd.

**Detharrapporteratsfallallavprogressivärrbildningilungvävnadvidbehandlingmedtelmisartan.

Manvetdockinteomtelmisartanärorsaken.

Eventuellabiverkningarmedenbarthydroklortiazid:

Hospatientersomenbartanvänderhydroklortiazidhardessutomföljandebiverkningarrapporterats:

Biverkningarutankändfrekvens(frekvenskaninteberäknasfråntillgängligadata):

Inflammationisalivkörtel

Minskatantalblodkroppar,inklusivelågtantalrödaochvitablodkroppar,lågtantalblodplättar

(trombocytopeni)

Allvarligaallergiskareaktioner(t.ex.överkänslighet,anafylaktiskareaktioner)

Minskadaptitelleraptitlöshet

Rastlöshet,yrsel

Dimsynellergulfärgatsynfält,synnedsättningochögonsmärta(möjligateckenpåakut

vinkelglaukom)

Inflammationiblodkärl(nekrotiserandevaskulit),inflammeradbukspottkörtel,oroligmage

Gulnadhudellergulnadeögon(gulsot)

Lupusliknandesyndrom(etttillståndliknandeensjukdomkalladsystemisklupuserythematosusdär

kroppensimmunförsvarangriperdenegnakroppen)

Hudsjukdomarsåsominflammeradeblodkärlihuden,ökadkänslighetförsolljusellerblåsoroch

fjällningpådetöverstahudlagret(toxiskepidermalnekrolys)

Svaghet

Njurinflammationellerförsämradnjurfunktion

Glukosiurinen(glykosuri)

Feber

Nedsattelektrolytbalans

Högablodkolesterolnivåer

Minskadblodvolym

Ökadenivåeravglukosellerfettiblodet.

Omdufårbiverkningar,talamedläkareellerapotekspersonal. Dettagälleräveneventuellabiverkningarsom

intenämnsidennainformation.

Rapporteringavbiverkningar

Omdufårnågrabiverkningar,talameddinläkareellerapotekspersonal.Dettagälleräveneventuella

biverkningarsomintenämnsidennainformation.Dukanocksåanmälabiverkningardirektvia:

Läkemedelsverket

Läkemedelsverket2015-02-02

Box26

75103Uppsala

Webbplats: www.lakemedelsverket.se

Genomattrapporterabiverkningarkandubidratillattökainformationenomläkemedelssäkerhet.

5. HurTelmisartan/HydrochlorothiazideGlenmarkskaförvaras

Förvaradettaläkemedelutomsyn-ochräckhållförbarn.

AnvändsföreutgångsdatumsomangespåkartongenefterEXP.Utgångsdatumetärdensistadageniangiven

månad.

Förvarasioriginalförpackningen.Fuktkänsligt.

Användintedettaläkemedelomdumärkeratttabletternaärmissfärgade.

Läkemedelskaintekastasiavloppetellerblandhushållsavfall.Frågaapotekspersonalenhurmankastar

läkemedelsomintelängreanvänds.Dessaåtgärderärtillförattskyddamiljön.

6. Förpackningensinnehållochövrigaupplysningar

Innehållsdeklaration

Deaktivasubstansernaärtelmisartanochhydroklortiazid.

Varjetablettinnehåller80mgtelmisartanoch12,5mghydroklortiazid.

Övrigainnehållsämnenärkrospovidon(typA),hypromellos,laktosmonohydrat,magnesiumstearat,mannitol,

meglumin,povidon,kolloidalvattenfrikiseldioxid,natriumhydroxid,natriumstearylfumarat,talk,rödjärnoxid

(E172).

Läkemedletsutseendeochförpackningsstorlekar

Telmisartan/HydrochlorothiazideGlenmarktabletterärbikonvexa,två-skiktade,kapselformadeodragerade

tabletterdärhydroklortiazid-skiktetärvitttillbenvitt,präglatmed"424"ochtelmisartan-skiktetärfläckigt

orangetillrödbrunt,utanprägling.Hydroklortiazid-skiktetkaninnehållarödaktiga,brunafläckar.

Telmisartan/hydroklorotiazidtabletterfinnstillgängligaiblisterförpackningarmed14,28,30,

56,90eller98tabletter.Eventuelltfinnsinteallaförpackningsstorlekartillgängligai

dittland.

Innehavareavgodkännandeförförsäljning

GlenmarkPharmaceuticalsEuropeLimited

LaxmiHouse,2BDraycottAvenue,

Kenton,Middlesex,HA30BU.

Storbritannien

Tillverkare

GlenmarkPharmaceuticalsEuropeLimited

Building2,CroxleyGreenBusinessPark,CroxleyGreen,

Hertfordshire,WD188YA

Storbritannien

GlenmarkPharmaceuticalss.r.o.

Fibíchova143,56617VysokéMýto

Tjeckien

Läkemedelsverket2015-02-02

TillomedLaboratoriesLimited,

3HowardRoad,EatonSocon,StNeots,Cambridgeshire,

PE198ET

Storbritannien

DettaläkemedelärgodkäntinomEuropeiskaekonomiskasamarbetsområdetundernamnen:

Tyskland:

Telmisartan/HydrochlorothiazidGlenmark

Frankrike,Sverige:

Telmisartan/HydrochlorothiazideGlenmark

Espanien,Portugal:

Telmisartan/HidroclorotiazidaGlenmark

Nederländerna:

Telmisartan/HydrochloorthiazideGlenmark

Storbritannien:

Telmisartan/Hydrochlorothiazide

Dennabipacksedeländradessenast2015-02-02

Läs hela dokumentet

Läkemedelsverket2015-02-02

PRODUKTRESUMÉ

LÄKEMEDLETSNAMN

Telmisartan/HydrochlorothiazideGlenmark80mg/12,5mgtabletter

2. KVALITATIVOCHKVANTITATIVSAMMANSÄTTNING

Varjetablettinnehåller80mgtelmisartanoch12,5mghydroklortiazid.

Hjälpämne(n)medkändeffekt:

Varjetablettinnehåller499,4mglaktosmonohydrat

Förfullständigförteckningöverhjälpämnen,seavsnitt6.1.

3. LÄKEMEDELSFORM

Tablett

Bikonvexa,ca19mmbreda,två-skiktade,kapselformadeodrageradetabletterdärhydroklortiazid-skiktetär

vitttillbenvitt,präglatmed"424"ochtelmisartan-skiktetärfläckigtorangetillrödbrunt,utanprägling.

Hydroklortiazid-skiktetkaninnehållarödaktiga,brunafläckar.

4. KLINISKAUPPGIFTER

4.1 Terapeutiskaindikationer

Behandlingavessentiellhypertoni.

Telmisartan/HydrochlorothiazideGlenmarkfastdoskombination(80mgtelmisartan/12,5mghydroklortiazid)

äravseddförvuxnavarsblodtryckintekankontrollerasadekvatavenbarttelmisartan.

4.2 Doseringochadministreringssätt

Dosering

Telmisartan/HydrochlorothiazideGlenmarkskatasavpatientervarsblodtryckintekankontrollerasadekvat

avenbarttelmisartan.Individuelldostitreringavvarochenavdetvåkomponenternarekommenderasinnan

manbytertilldenfastadoskombinationen.Närdetärklinisktlämpligtkanmanövervägadirektbytefrån

monoterapitilldenfastakombinationen.

Telmisartan/HydrochlorothiazideGlenmark40mg/12,5mgkangestillpatientervarsblodtryckinte

kankontrollerasadekvatavtelmisartan40mg

Telmisartan/HydrochlorothiazideGlenmark80mg/12,5mgkangestillpatientervarsblodtryckinte

kankontrollerasadekvatavtelmisartan80mg

Särskildapatientgrupper:

Patientermednedsattnjurfunktion

Regelbundenkontrollavnjurfunktionenrekommenderas(seavsnitt4.4).

Samtidiganvändningavtelmisartanmedaliskirenärkontraindicerathospatientermednedsattnjurfunktion

(GFR<60ml/min/1,73m2)(seavsnitt4.3).

Patientermednedsattleverfunktion

Läkemedelsverket2015-02-02

HospatientermedlätttillmåttligtnedsattleverfunktionbördosenavTelmisartan/Hydrochlorothiazide

Glenmarkejöverstiga40mg/12,5mgengångdagligen.Telmisartan/HydrochlorothiazideGlenmarkärinte

indicerattillpatientermedsvårtnedsattleverfunktion.Tiaziderskaanvändasmedförsiktighethospatienter

mednedsattleverfunktion(seavsnitt4.4).

Äldrepatienter

Ingendosjusteringärnödvändig.

Pediatriskpopulation

SäkerhetenocheffektenavTelmisartan/Hydrochlorothiazidehosbarnochungdomarunder18årharinte

fastställts.Ingadatafinnstillgängliga.

Administreringssätt

Telmisartan/HydrochlorothiazideGlenmarktabletterärföroraladministreringengångdagligenochbörtas

medvätska,medellerutanmat.

Försiktighetsåtgärdersomskavidtasförehanteringelleradministreringavläkemedlet

Telmisartan/HydrochlorothiazideGlenmarkbörförvarasidenförslutnablisterförpackningenpågrundav

tabletternashygroskopiskaegenskaper.Tabletternabörtasuturblisterförpackningenstraxföre

administrering(seavsnitt6.6).

4.3 Kontraindikationer

Överkänslighetmotnågonavdeaktivasubstansernaellermotnågothjälpämnesåsomangiveti

avsnitt6.1.

Överkänslighetmotandrasulfonamid-derivat(eftersomhydroklortiazidärettsulfonamid-derivat).

Andraochtredjetrimesternavgraviditet(seavsnitt4.4och4.6).

Gallstasochgallvägsobstruktion.

Svårtnedsattleverfunktion.

Gravtnedsattnjurfunktion(kreatininclearance<30ml/min).

Refraktärhypokalemi,hyperkalcemi.

SamtidiganvändningavTelmisartan/HydrochlorothiazideGlenmarkochproduktersominnehålleraliskirenär

kontraindiceradhospatientermeddiabetesmellitusellernedsattnjurfunktion(GFR<60ml/min/1.73m 2 )(se

avsnitt4.5och5.1).

4.4 Varningarochförsiktighet

Graviditet

BehandlingmedangiotensinII-antagonisterbörintepåbörjasundergraviditet.Omintefortsattbehandling

medangiotensinII-antagonisteransesvaranödvändig,börpatientersomplanerarförengraviditeterhålla

alternativbehandlingdärsäkerhetsprofilenärväletableradföranvändningundergraviditet.Vidkonstaterad

graviditetbörbehandlingmedangiotensinII-antagonisteravbrytasomedelbartoch,ifalldetärlämpligt,bör

enalternativbehandlingpåbörjas(seavsnitt4.3och4.6).

Nedsattleverfunktion

Telmisartan/HydrochlorothiazideGlenmarkbörintegestillpatientermedgallstas,gallvägsobstruktioneller

svårleverinsufficiens(seavsnitt4.3),eftersomtelmisartanhuvudsakligeneliminerasviagallan.Dessa

patienterkanförväntashareducerathepatisktclearanceförtelmisartan.

Läkemedelsverket2015-02-02

DessutombörTelmisartan/HydrochlorothiazideGlenmarkanvändasmedförsiktighethospatientermed

nedsattleverfunktionellerprogressivleversjukdom,eftersommindreförändringaravvätske-och

elektrolytbalansenkanutlösaleverkoma.Detfinnsingenkliniskerfarenhetav

Telmisartan/HydrochlorothiazideGlenmarkhospatientermednedsattleverfunktion.

Renovaskulärhypertoni

Detfinnsenökadriskförallvarlighypotensionochnjurinsufficiensnärpatientermedbilateralnjurartärstenos

ellerstenosiartärentillenendafungerandenjurebehandlasmedläkemedelsompåverkarrenin-angiotensin-

aldosteronsystemet.

Nedsattnjurfunktionochnjurtransplantation

Telmisartan/HydrochlorothiazideGlenmarkbörinteanvändaspåpatientermedgravtnedsattnjurfunktion

(kreatinin-clearance<30ml/min)(seavsnitt4.3).Detfinnsingenerfarenhetavbehandlingmed

Telmisartan/Hydrochlorothiazidehospatientersomnyligengenomgåttennjurtransplantation.Erfarenheten

avTelmisartan/Hydrochlorothiazideärbegränsadnärdetgällerpatientermedmildtillmåttligtnedsatt

njurfunktionochdärförrekommenderasregelbundenkontrollavkalium-,kreatinin-ochurinsyranivåernai

serum.Tiaziddiuretika-associeradazotemikaninträffahospatientermednedsattnjurfunktion.

Intravaskulärhypovolemi

Symtomatiskhypotoni,särskiltefterdenförstadosen,kanförekommahospatientersomärietttillståndav

volym-och/ellernatriumdepletionpågrundavalltförintensivbehandlingmeddiuretika,dietär

saltbegränsning,diarréellerkräkningar.Sådanasymtommåsteåtgärdasinnanbehandlingmed

Telmisartan/Hydrochlorothiazidekanpåbörjas.

Dubbelblockadavrenin-angiotensin-aldosteron-systemet(RAAS)

DetharvisatsattsamtidiganvändningavACE-hämmare,angiotensinII-receptorblockerareelleraliskiren

ökarriskenförhypotoni,hyperkalemiochnedsattnjurfunktion(inklusiveakutnjursvikt).Dubbelblockadav

RAASviakombineradanvändningavACE-hämmare,angiotensinII-receptorblockerareelleraliskiren

rekommenderasdärförinte(seavsnitt4.5och5.1).

Omdetansesvaraabsolutnödvändigtmeddubbelblockadfårdettaendastutförasunderövervakningaven

specialist,ochpatientenskaståunderregelbunden,noggrannövervakningavnjurfunktion,elektrolyteroch

blodtryck.

ACE-hämmareochangiotensinII-receptorblockerarebörinteanvändassamtidigthospatientermed

diabetesnefropati .

Andratillståndsomstimulerarrenin-angiotensin-aldosteron-systemet

Hospatientervarskärltonusochnjurfunktionhuvudsakligenstyrsavaktivitetenirenin-angiotensin-

aldosteron-systemet(t.ex.patientermedsvårhjärtsviktellerbakomliggandenjursjukdom,inklusive

njurartärstenos),harbehandlingmedläkemedelsompåverkardettasystemförknippatsmedakuthypotension,

azotemi,oliguriellerisällsyntafallakutnjursvikt(seavsnitt4.8).

Primäraldosteronism

Patientermedprimäraldosteronismsvarariallmänhetintepåantihypertensivaläkemedelsomverkargenom

hämningavrenin-angiotensin-systemet.Därförrekommenderasanvändingav

Telmisartan/HydrochlorothiazideGlenmarkinte.

Aorta-ochmitralisklaffstenos,obstruktivhypertrofiskkardiomyopati

Liksommedandravasodilaterandeläkemedelbörförsiktighetiakttashospatientermedaorta-eller

mitralisstenosellerobstruktivhypertrofiskkardiomyopati.

Läkemedelsverket2015-02-02

Metabolaochendokrinaeffekter

Behandlingmedtiazidkanförsämraglukostoleransen,medanhypoglykemikanuppträdahospatientermed

diabetesvidinsulin-ellerdiabetesbehandlingochbehandlingmedtelmisartan.Därförbörmanöverväga

blodglukoskontrollhosdessapatienter,endosjusteringavinsulinellerantidiabetikakankrävas,omdet

indiceras.Latentdiabetesmellituskanmanifesterasigunderbehandlingenmedtiazid.

Ökadekolestrol-ochtriglyceridnivåerharförknippatsmedbehandlingmedtiaziddiuretika;dockharminimala

elleringaeffekterrapporteratsvid12,5mgdosavTelmisartan/HydrochlorothiazideGlenmark.Hyperurikemi

kanförekommaellermanifestgiktkanutlösashosvissapatientersomfårbehandlingmedtiazid.

Elektrolytrubbningar

Somförallapatientersombehandlasmeddiuretika,börregelbundenbestämningavserumelektrolytergöras

vidlämpligaintervall.Tiazider,inklusivehydroklortiazid,kanorsakarubbningarivätske-eller

elektrolytbalansen(inklusivehypokalemi,hyponatremiochhypokloremiskalkalos).Varningsteckenpå

vätske-ellerelektrolytobalansärmuntorrhet,törst,asteni,letargi,trötthet,rastlöshet,muskelsmärtaeller

kramper,muskeltrötthet,hypotension,oliguri,takykardiochgastrointestinalastörningarsåsomillamående

ellerkräkningar(seavsnitt4.8).

Hypokalemi

Ävenomhypokalemikanutvecklasvidanvändningavtiaziddiuretika,såkansamtidigbehandlingmed

telmisartanminskadendiuretika-induceradehypokalemin.Riskenförhypokalemiärstörsthospatientermed

levercirros,patientermedpåskyndaddiures,patientersomfårotillräckligtoraltintagavelektrolyterochhos

patientersomfårsamtidigbehandlingmedkortikosteroiderelleradrenokortikotropthormon(ACTH)(se

avsnitt4.5).

Hyperkalemi

Däremotkanhyperkalemiuppstå,pågrundavantagonismenavangiotensin-II(AT1)-receptorerav

telmisartan-komponenteniTelmisartan/HydrochlorothiazideGlenmark.Ävenomklinisktsignifikant

hyperkalemiintehardokumenteratsmedTelmisartan/HydrochlorothiazideGlenmark,föreliggerriskfaktorer

förutvecklingavhyperkalemiinklusivenjurinsufficiensoch/ellerhjärtsviktsamtdiabetesmellitus.

Kaliumsparandediuretika,kaliumtillskottellerkaliumhaltigasaltersättningsmedelböradministrerasmed

försiktighettillsammansmedTelmisartan/HydrochlorothiazideGlenmark(Seavsnitt4.5).

Hyponatremiochhypokloremiskalkalos

DetfinnsingetbeläggförattTelmisartan/HydrochlorothiazideGlenmarkminskarellerförebyggerdiuretika-

induceradhyponatremi.Kloridbristäriallmänhetmildochkrävervanligenintenågonbehandling.

Hyperkalemi

Tiaziderkanminskautsöndringenavkalciumiurinenochorsakaenintermittentochlättstegringav

serumkalciumifrånvaroavkändarubbningarikalciummetabolismen.Uttaladhyperkalcemikanvaratecken

pådoldhyperparatyroidism.Tiaziderskasättasutinnanparatyreoideafunktionenkontrolleras.

-Hypomagnesemi

Tiaziderharvisatsigökaurinutsöndringenavmagnesium,vilketkanledatillhypomagnesemi(seavsnitt4.5).

Akutmyopiochtrångvinkelglaukom

Hydroklortiazid,somärensulfonamid,kanorsakaenidiosynkratiskreaktion,vilketresulterariakut

övergåendemyopiochakuttrångvinkelglaukom.Symtomeninkluderarakutinsättandeförsämringav

synskärpaellerögonsmärtaochinträffarvanligtvisinomtimmartillveckorefterinsättningavläkemedlet.

Obehandladakuttrångvinkelglaukomkanledatillpermanentsynnedsättning.Denprimärabehandlingenäratt

sättauthydroklortiazidsåsnabbtsommöjligt.Snabbamedicinskaellerkirurgiskabehandlingarkanbehöva

övervägasomdetintraokuläratrycketförblirokontrollerat.Riskfaktorerförattutvecklaakut

Läkemedelsverket2015-02-02

trångvinkelglaukomkaninkluderatidigaresulfonamid-ellerpenicillinallergi.

Laktosmonohydrat

Dettaläkemedelinnehållerlaktosmonohydrat.Patientermedsällsyntaärftligaproblemmedfruktosintolerans

och/ellermedsällsyntaärftligaproblemmedgalaktosintolerans,totallaktasbristellerglukos-

galaktosmalabsorptionbörintetadettaläkemedel.

Etniskaskillnader

LiksomandraangiotensinII-antagonister,ärtelmisartanuppenbartmindreeffektivpåattsänkablodtrycket

hossvartapatienteränhosicke-svarta,möjligenberoendepåenhögreprevalensavlågareninnivåeriden

svartahypertensivapopulationen.

Övrigt

Sommedallaantihypertensivaläkemedel,kanöverdrivenblodtryckssänkninghospatientermedischemisk

hjärtsjukdomellerischemiskkardiovaskulärsjukdomledatillhjärtinfarktellerstroke.

Allmänt

Överkänslighetsreaktionermothydroklortiazidkaninträffahospatientermedellerutananamnespåallergi

ellerbronkialastma,menärmertrolighospatientermedsådanbakgrund.

Försämringelleraktiveringavsystemisklupuserythematosusharrapporteratsvidanvändningav

tiaziddiuretika,däriblandhydroklortiazid.

Fallavfotosensitivitetsreaktionerharrapporteratsmedtiaziddiuretika(seavsnitt4.8).Omen

fotosensitivitetsreaktionuppträderunderbehandling,rekommenderasdetattbehandlingenavbryts.Omett

återinsättandeavdiuretikabehandlingenbedömssomnödvändig,rekommenderasattutsattaområdenskyddas

motsolellerartificielltUVA-ljus.

4.5 Interaktionermedandraläkemedelochövrigainteraktioner

Litium

Reversiblaökningaravserumlitiumkoncentrationerochtoxicitetharrapporteratsvidsamtidiganvändningav

litiummedACE-hämmare.SällsyntafallharävenrapporteratsmedangiotensinII-antagonister(inklusive

Telmisartan/Hydrochlorothiazide).SamtidigbehandlingmedlitiumochTelmisartan/Hydrochlorothiazide

Glenmarkrekommenderasinte(seavsnitt4.4).Omkombinationenärnödvändig,rekommenderasnoggrann

kontrollavlitiumnivåniserumvidsamtidiganvändning.

Läkemedelsomkanmedförakaliumförlustochhypokalemi(t.ex.andrakalium-diuretika,laxermedel,

kortikosteroider,ACTH,amfotericin,karbenoxolon,penicillinG-natrium,salicylsyraochderivat)

Omdessasubstanserärtänktaattförskrivassamtidigtmedkombinationenhydroklortiazid-telmisartan

rekommenderaskontrollavkaliumnivåernaiplasma.Dessaläkemedelkanförstärkaeffektenav

hydroklortiazidpåserumkalium(seavsnitt4.4).

Läkemedelsomkanökakaliumnivåerellerinducerahyperkalemi(ACE-hämmare,kaliumsparandediuretika,

kaliumtillskott,saltersättningarsominnehållerkalium,ciklosporinellerandraläkemedelsomheparin-natrium)

Omdessasubstanserärtänktaattförskrivassamtidigtmedkombinationenhydroklortiazid-telmisartan

rekommenderaskontrollavkaliumnivåernaiplasma.Baseratpåerfarenhetavanvändningavandra

läkemedelsomhämmarreninangiotensinsystemet,kansamtidiganvändningavdessaläkemedelledatillökat

serumkaliumochkandärförinterekommenderas(seavsnitt4.4).

Läkemedelsompåverkasavstörningariserumkalium

Läkemedelsverket2015-02-02

RegelbundenkontrollavserumkaliumochEKGrekommenderasnärTelmisartan/Hydrochlorothiazide

Glenmarkgestillsammansmeddessaläkemedelsompåverkasavstörningariserumkalium(t.ex.

digitalisglykosider,antiarytmika)ochföljandeläkemedelmotTorsadedepointes(sominkluderarvissa

antiarytmika),eftersomhypokalemiärenpredisponerandefaktorförTorsadedepointes.

KlassIaantiarytmika(t.ex.kinidin,hydrokinidin,disopyramid)

KlassIIIantiarytmika(t.ex.amiodaron,sotalol,dofetilid,ibutilid)

Vissaantipsykotiskaläkemedel(t.ex.tioridazin,klorpromazin,levomepromazin,trifluoperazin,

cyamemazine,sulpirid,sultoprid,amisulprid,tiaprid,pimozid,haloperidol,droperidol)

Övriga(t.ex.bepridil,cisaprid,difemanil,erytromycinIV,halofantrin,mizolastin,pentamidin,

sparfloxacin,terfenadin,vinkaminIV)

Digitalisglykosider

Tiazidinduceradhypokalemiellerhypomagnesemikanledatilldigitalis-induceradarytmi(seavsnitt4.4).

Digoxin

Närtelmisartangavstillsammansmeddigoxin,kundemedianökningaravdigoxinmaximal

plasmakoncentration(49%)ochidalvärdeskoncentrationen(20%)observeras.Vidstart,justeringoch

utsättningavtelmisartan,skadigoxinnivåernaövervakasförattbibehållanivåerinomdetterapeutiska

intervallet.

Andraantihypertensivamedel

Telmisartankanökadenblodtryckssänkandeeffektenavandraantihypertensivaläkemedel.

Datafrånkliniskaprövningarharvisatattförekomstenavbiverkningarsomhypotoni,hyperkalemioch

nedsattnjurfunktion(inklusiveakutnjursvikt)ärhögreviddubbelblockadavrenin-angiotensin-aldosteron-

systemet(RAAS)genomkombineradanvändningavACE-hämmare,angiotensinII-receptorblockerareeller

aliskirenjämförtmedanvändningavettendaläkemedelsompåverkarRAAS(seavsnitt4.3,4.4och5.1) .

Diabetesläkemedel(oralaantidiabetikaochinsulin)

Dosjusteringavdiabetesläkemedelkanbehövas(seavsnitt4.4).

Metformin

Metforminböranvändasmedförsiktighet:detfinnsriskförlaktacidossomutlösesaveneventuellfunktionell

njurinsufficiensknutentillhydroklortiazid.

Kolestyraminochkolestipol

Absorptionenavhydroklortiazidförsämrasinärvaroavanjonbytare.

Icke-steroidaantiinflammatoriskaläkemedel

NSAID(dvs.acetylsalicylsyraiantiinflammatoriskdos,COX-2-hämmareochicke-selektivaNSAID)kan

minskadendiuretiska,natriuretiskaochantihypertensivaeffektenavtiazid-diuretikaochdenantihypertensiva

effektenavangiotensinII-antagonister.

Hosvissapatientermednedsattnjurfunktion(t.ex.t.ex.dehydreradepatienterelleräldrepatientermednedsatt

njurfunktion)kansamtidiganvändningavangiotensinII-antagonisterochläkemedelsomhämmar

cyklooxygenasledatillytterligareförsämringavnjurfunktionen,eventuelltinklusiveakutnjursvikt,som

vanligtvisärreversibel.Avdetskäletskakombinationenanvändasmedförsiktighet,särskilthosäldre

patienter.Patienterskavaraadekvathydreradeochmanbörövervägauppföljningavnjurfunktionenefter

insättandetavsamtidigbehandlingochregelbundetdärefter.

IenstudiemedsamtidigtillförselavtelmisartanochramiprilökadeAUC

0-24 och

Cmax avramipriloch

ramiprilatupptill2,5gånger.Denkliniskarelevansenavdennaobservationärintekänd.

Läkemedelsverket2015-02-02

Pressorsubstanser(t.ex.noradrenalin)

Effektenavdessapressor-aminerkanminska.

Icke-depolariserandemuskelavslappnandemedel(t.ex.tubokurarin)

Effektenavicke-depolariserandemuskelavslappnandemedelkanförstärkasavhydroklortiazid.

Läkemedelförbehandlingavgikt(t.ex.probenecid,sulfinpyrazonochallopurinol)

Dosjusteringavdenurinsyradrivandebehandlingenkanvaranödvändigeftersomhydroklortiazidkanhöja

nivånavurinsyraiserum.Höjddosavprobenecidellersulfinpyrazonkankrävas.Samtidigtillförselav

tiaziderkanledatillökadincidensavöverkänslighetsreaktionermotallopurinol.

Kalciumsalter

Tiaziddiuretikakanökaserumkalciumpga.minskadutsöndring.Omkalciumtillskottmåsteförskrivas,bör

serumkalciumnivåernaföljasuppochkalciumdosenjusterasienlighetdärmed.

Betablockerareochdiazoxid

Denhyperglykemiskaeffektenavbetablockerareochdiazoxidkanförstärkasavtiazider.

Antikolinergika(t.ex.atropin,biperiden)kanökabiotillgänglighetenavdiuretikaav

tiazid-typgenomminskadgastrointestinalmotilitetochmagtömningshastighet.

Amantadin

Tiaziderkanökariskenförbiverkningarorsakadeavamantadin.

Cytotoxiskamedel(t.ex.cyklofosfamid,metotrexat)

Tiaziderkanminskadenrenalautsöndringenavcytotoxiskaläkemedelochpotentieraderasmyelosuppressiva

effekt.

Baseratpåderasfarmakologiskaegenskaperkandetförväntasattföljandeläkemedelkanpotentieraden

hypotensivaeffekternaavantihypertensivaläkemedelinklusivetelmisartan:Baklofen,amifostin.

Dessutomkanortostatiskhypotensionförvärrasavalkohol,barbiturater,narkotikaochantidepressiv

läkemedel.

4.6Fertilitet,graviditetochamning

Graviditet

AngiotensinII-antagonisterbörinteanvändasunderdenförstatrimesternavgraviditeten(seavsnitt4.4).

AngiotensinII-antagonisterärkontraindiceradeunderandraochtredjetrimesternavgraviditet(seavsnitt4.3

och4.4).

DetfinnsingaadekvatadatafrånbehandlingavTelmisartan/Hydrochlorothiazidehosgravidakvinnor.

Djurstudierharvisatreproduktionstoxicitet(seavsnitt5.3).

EpidemiologiskadataröranderiskförfosterskadaefteranvändningavACE-hämmareundergraviditetens

förstatrimesterärinteentydigaochennågotökadriskkaninteuteslutas.Medandetfinnsingakontrollerade

epidemiologiskadataröranderiskenmedangiotensinII-antagonisterkanlikartaderiskerföreliggafördenna

läkemedelsgrupp.OmintefortsattbehandlingmedangiotensinII-antagonisteransesvaranödvändig,bör

patientersomplanerarförengraviditeterhållaalternativbehandlingdärsäkerhetsprofilenärväletableradför

Läkemedelsverket2015-02-02

användningundergraviditet.VidkonstateradgraviditetbörbehandlingmedangiotensinII-antagonister

avbrytasomedelbartoch,ifalldetärlämpligt,börenalternativbehandlingpåbörjas.

ExponeringförangiotensinII-antagonisterunderandraochtredjetrimesternkaninducerahuman

fostertoxicitet(nedsattnjurfunktion,oligohydramnios,hämningavskallförbening)ochneonataltoxicitet

(njursvikt,hypotension,hyperkalemi).(seavsnitt5.3).OmexponeringförangiotensinII-antagonister

förekommitundergraviditetensandratrimesterrekommenderasultraljudskontrollavnjurfunktionochskalle.

SpädbarnvarsmödrarharanväntangiotensinII-antagonisterbörobserverasnoggrantmedavseendepå

hypotoni(seavsnitt4.3och4.4).

Detfinnsbegränsaderfarenhetavhydroklortiazidundergraviditet,särskiltunderdenförstatrimestern.

Djurstudierärotillräckliga.Hydroklortiazidpasserarplacentan.Baseratpådenfarmakologiska

verkningsmekanismenförhydroklortiazidkananvändningunderandraochtredjetrimesternäventyra

fetoplacentärperfusionochkanorsakafetalaochneonatalaeffektersomikterus,störningari

elektrolytbalansenochtrombocytopeni.Hydroklortiazidskainteanvändasvidgraviditetsödem,

graviditetshypertoniellerhavandeskapsförgiftningpågrundavriskenförminskadplasmavolymoch

försämradplacentagenomblödningutanattsjukdomsförloppetpåverkaspositivt.

Hydroklortiazidskainteanvändasvidessentiellhypertonihosgravidakvinnorförutomisällsyntasituationer

dåingenannanbehandlingkananvändas.

Amning

EftersomingeninformationnärdetgälleranvändningavTelmisartan/Hydrochlorothiazideunderamningen

finns,äranvändningavTelmisartan/Hydrochlorothiazideunderamningintetillrådig,ochalternativa

behandlingarmedbättredokumenteradsäkerhetsprofilärattföredra,specielltvidamningavnyföddaeller

prematurabarn.

Hydroklortiazidutsöndrasibröstmjölkismåmängder.Tiaziderihögadosersomorsakarintensivdiureskan

hämmamjölkproduktionen.AnvändningavTelmisartan/Hydrochlorothiazidevidamningrekommenderasinte.

OmTelmisartan/Hydrochlorothiazideanvändsunderamningbördosernahållassålågasommöjligt.

Fertilitet

Iprekliniskastudierharingaeffekteravtelmisartanochhydroklortiazidpåmanligellerkvinnligfertilitet

observerats.

4.7 Effekterpåförmåganattframförafordonochanvändamaskiner

Vidframförandeavfordonelleranvändningavmaskinerbördettasibeaktandeattyrselellerdåsighet

emellanåtkanuppträdanärmantarblodtryckssänkandeläkemedelsomTelmisartan/Hydrochlorothiazide.

4.8 Biverkningar

Sammanfattningavsäkerhetsprofilen

Denvanligastrapporteradebiverkningenäryrsel.Allvarligtangioödemkanförekommaisällsyntafall(≥1/10

000till<1/1000).

DentotalaincidensenavbiverkningarsomrapporteradesmedTelmisartan/Hydrochlorothiazidevarjämförbar

meddensomobserveratsmedenbarttelmisartanirandomiseradekliniskastudierhos1471patientersom

randomiseratsförbehandlingmedtelmisartanplushydroklortiazid(835)ellerenbarttelmisartan(636).

Förekomstenavbiverkningariförhållandetilldoskundeintefastställas,ochvisadeingenkorrelationmed

patienternaskön,ålderellerras.

Sammanfattningavbiverkningaritabellform

Läkemedelsverket2015-02-02

Biverkningarsomharrapporteratsikliniskastudierochsomförekomoftare(p≤0,05)medtelmisartanplus

hydroklortiazidänmedplacebovisasnedanenligtsystemorganklass.Biverkningarsomärkändavid

behandlingmedenavkomponenternavarförsig,mensominteharsettsikliniskaprövningarkaninträffa

underbehandlingmedTelmisartan/Hydrochlorothiazide.

Biverkningarnaharsorteratsenligtfrekvensenligtföljandekonvention:mycketvanliga(≥1/10),vanliga(≥

1/100till<1/10),mindrevanliga(≥1/1000till<1/100),sällsynta(≥1/10000till<1/1000),mycketsällsynta

(<1/10000),ingakända(kaninteberäknasfråntillgängligadata).

Inomvarjefrekvensområdepresenterasbiverkningarnaifallandeallvarlighetsgrad.

Infektionerochinfestationer

Sällsynta: Bronkit,faryngit,sinuit

Störningariimmunsystemet

Sällsynta: Försämringelleraktiveringavsystemisklupuserythematosus 1

Ämnesomsättningssjukdomarochmetabolastörningar

Ovanliga: Hypokalemi

Sällsynta: Hyperurikemi,hyponatremi

Psykiskastörningar

Ovanliga: Ångest

Sällsynta: Depression

Störningarinervsystemet

Vanliga: Yrsel

Ovanliga: Synkope,parestesier

Sällsynta: Sömnlöshet,sömnstörningar

Ögon

Sällsynta: Synstörningar,dimsyn

Öronochbalansorgan

Ovanliga: Vertigo

Hjärtbesvär

Ovanliga: Takykardi,arytmier

Blodkärl

Ovanliga: Hypotension,ortostatiskhypotension

Besväriandningsvägar,bröstkorgochmediastinum

Ovanliga: Dyspné

Sällsynta: Andnöd(inklusivepneumonitochlungödem)

Störningarimag-tarmkanalen

Ovanliga:Diarré,muntorrhet,flatulens

Sällsynta: Buksmärta,förstoppning,dyspepsi,kräkningar,gastrit

Lever-ochgallvägsstörningar

Sällsynta: Onormalleverfunktion/leversjukdom 2

Störningarihudochsubkutanvävnad

Sällsynta: Angioödem(ävenmeddödligutgång),rodnad,klåda,hudutslag,hyperhidros,

urtikaria

Muskuloskeletalasystemet,bindvävochbenvävnad

Ovanliga: Ryggsmärta,muskelspasmer,myalgi

Läkemedelsverket2015-02-02

Sällsynta: Artralgi,muskelkramper,smärtaiarmarochben

Reproduktionsorganochbröstkörtel

Ovanliga: Erektildysfunktion

Allmännabesvärochbesvärvidadministreringsstället

Ovanliga: Bröstsmärta

Sällsynta: Influensaliknandesjukdom,smärta

Undersökningar

Ovanliga: Förhöjdahalteravurinsyraiblodet

Sällsynta: Förhöjtblodkreatinin,förhöjtblodkreatinfosfokinas,förhöjdaleverenzymer

1:Baseratpåuppföljningeftergodkännande

2:Seunderavsnittet"Beskrivningavutvaldabiverkningar"förytterligarebeskrivning.

Ytterligareinformationomdeenskildakomponenterna

Debiverkningarsomtidigarerapporteratsmedenavdeenskildakomponenternakanvarapotentiella

biverkningarmedTelmisartan/Hydrochlorothiazide,Ävenomdeinteobserveratsikliniskastudiermeddenna

produkt.

Telmisartan:

Biverkningarförekommedlikartadfrekvenshospatienterbehandlademedplaceboochtelmisartan.

Dentotalaincidensenavbiverkningarsomrapporteradesmedtelmisartan(41,4%)varvanligenjämförbar

medplacebo(43,9%)iplacebokontrolleradestudier.Följandebiverkningarsomlistasnedanharrapporterats

frånallakliniskastudierhospatientersombehandlasmedtelmisartanförhypertensionellerpatienter50år

elleräldremedhögriskförkardiovaskulärahändelser.

Infektionerochinfestationer

Ovanliga: Övreluftvägsinfektion,urinvägsinfektioninklusivecystit

Sällsynta: Sepsis,ävenmedfatalutgång 3

Blodetochlymfsystemet

Ovanliga: Anemi

Sällsynta: Eosinofili,trombocytopeni

Störningariimmunsystemet

Sällsynta: Överkänslighet,anafylaktiskareaktioner

Ämnesomsättningssjukdomarochmetabolastörningar

Ovanliga: Hyperkalemi

Sällsynta: Hypoglykemi(hospatientermeddiabetes)

Hjärtbesvär

Ovanliga: Bradykardi

Störningarinervsystemet

Sällsynta: Somnolens

Besväriandningsvägar,bröstkorgochmediastinum

Ovanliga: Hosta

Mycketsällsynta: Interstitielllungsjukdom 3

Störningarimag-tarmkanalen

Läkemedelsverket2015-02-02

Sällsynta: Magbesvär

Störningarihudochsubkutanvävnad

Sällsynta: Eksem,läkemedelsutslag,toxiskahudutslag

Muskuloskeletalasystemet,bindvävochbenvävnad

Sällsynta: Artros,sensmärta

Njurarochurinvägar

Ovanliga: Nedsattnjurfunktion(inklusiveakutnjursvikt)

Allmännabesvärochbesvärvidadministreringsstället

Ovanliga: Asteni

Undersökningar

Sällsynta: Sänkthemoglobin

3:Seunderavsnittet"Beskrivningavutvaldabiverkningar"förytterligarebeskrivning.

Hydroklortiazid:

Hydroklortiazidkanorsakaellerförvärradenhypovolemisomkanledatillelektrolytstörningar(seavsnitt

4.4).

Biverkningarmedokändfrekvensrapporteratsvidanvändningavenbarthydroklortiazidinkluderar:

Infektionerochinfestationer

Ingakända: Sialadenit

Blodetochlymfsystemet

Ingakända: Aplastiskanemi,hemolytiskanemi,benmärgsdepression,leukopeni,neutropeni,

agranulocytos,trombocytopeni

Immunsystemet

Ingakända: Anafylaktiskareaktioner,överkänslighet

Endokrinasystemet

Ingakända: Diabetesmellitusotillräckligkontroll

Ämnesomsättningssjukdomarochmetabolastörningar

Ingakända: Anorexi,minskadaptit,elektrolytrubbningar,hyperkolesterolemi,hyperglykemi,

hypovolemi

Psykiskastörningar

Ingakända: Rastlöshet

Störningarinervsystemet

Ingakända: Yrsel

Ögon

Ingakända: Xantopsi,akutmyopi,akuttrångvinkelglaukom

Blodkärl

Ingakända: Nekrotiserandevaskulit

Störningarimag-tarmkanalen

Ingakända: Pankreatit,magbesvär

Lever-ochgallvägsstörningar

Ingakända: Hepatocellulärgulsot,kolestatiskgulsot

Läkemedelsverket2015-02-02

Störningarihudochsubkutanvävnad

Ingakända: Lupusliknandesyndrom,fotosensitivitetsreaktioner,hudvaskulit,toxiskepidermal

nekrolys

Muskuloskeletalasystemet,bindvävochbenvävnad

Ingakända: Svaghet

Njurarochurinvägar

Ingakända: Interstitiellnefrit,nedsattnjurfunktion,glykosuri

Allmännabesvärochbesvärvidadministreringsstället

Ingakända: Feber

Undersökningar

Ingakända: Förhöjdatriglycerider

Beskrivningavutvaldabiverkningar

Avvikandeleverfunktion/leversjukdom

Deflestafallavonormalleverfunktion/leversjukdombaseradepåuppföljningefteratttelmisartanhade

godkäntsförförsäljninginträffadehosjapanskapatienter.Japanskapatienterlöperstörreriskattfådessa

biverkningar.

Sepsis

IPRoFESS-studienobserveradesenökadincidensavsepsismedtelmisartanjämförtmedplacebo.Dessa

biverkningarkanvaraentillfällighetellerhasambandmedenmekanismsomförnärvarandeinteärkänd(se

avsnitt5.1).

Interstitielllungsjukdom

Fallavinterstitielllungsjukdomharrapporteratsefterattläkemedlethargodkäntsförförsäljningitidsmässigt

sambandmedintagavtelmisartan.Däremotharettorsakssambandintefastställts.

Rapporteringavmisstänktabiverkningar

Detärviktigtattrapporteramisstänktabiverkningarefterattläkemedlethargodkänts.Detgördetmöjligtatt

kontinuerligtövervakaläkemedletsnytta-riskförhållande.Hälso-ochsjukvårdspersonaluppmanasatt

rapporteravarjemisstänktbiverkningvia:

Läkemedelsverket

Box26

75103Uppsala

Webbplats: www.lakemedelsverket.se

4.9 Överdosering

Detfinnsbegränsadedataomöverdoseringavtelmisartanhosmänniskor.Ivilkenmånhydroklortiazid

avlägsnasgenomhemodialysärintefastställt.

Symtom

Demestframträdandetecknenpåöverdoseringmedtelmisartanvarhypotoniochtakykardi,menäven

bradykardi,yrsel,kräkningar,ökatserumkreatininochakutnjursviktharocksårapporterats.Överdosering

medhydroklortiazidärassocieradmedelektrolytutarmning(hypokalemi,hypokloremi)ochhypovolemi

orsakadavkraftigdiures.Devanligastetecknenochsymtomenpåöverdoseringärillamåendeochdåsighet.

Hypokalemikanledatillmuskelspasmeroch/elleraccentueraarytmierisambandmedsamtidiganvändningav

digitalisglykosiderellervissaantiarytmiskaläkemedel.

Läkemedelsverket2015-02-02

Behandling

Telmisartaneliminerasintegenomhemodialys.Patientenskaövervakasnoggrant,ochbehandlingenbörvara

symtomatiskochunderstödjande.Behandlingenberorpåtidenefterintagochsymtomenssvårighetsgrad.

Föreslagnaåtgärderärigångsättningavkräkningaroch/ellermagpumpning.Aktivtkolkanvaraanvändbart

vidbehandlingavöverdosering.Serumelektrolyterochkreatininbörföljasfrekvent.Omhypotoniuppträder,

skapatientenplacerasiryggläge,ochsnabbtgessaltochvätskeersättning.

5. FARMAKOLOGISKAEGENSKAPER

5.1 Farmakodynamiskaegenskaper

Farmakoterapeutiskgrupp:AngiotensinII-antagonisterochdiuretika,ATC-kod:C09DA07

Telmisartan/HydrochlorothiazideärenkombinationavenangiotensinII-antagonist,telmisartan,ochetttiazid-

diuretikum,hydroklortiazid.Kombinationenavdessasubstanserharenadditivblodtryckssänkandeeffektoch

minskarblodtrycketmerändeenskildakomponenternavarförsig.Telmisartan/Hydrochlorothiazideengång

dagligenledertilleffektivsänkningavblodtrycketinomdetterapeutiskadosintervallet.

Telmisartanär,oraltgiven,eneffektivochspecifikangiotensinII-receptor-subtyp(AT1)-antagonist.

TelmisartanträngermedmyckethögaffinitetbortangiotensinIIfrånbindningsställenapåAT1-receptorn,

somsvararfördekändaeffekternaavangiotensinII.Telmisartanuppvisaringeneffektsompartiellagonist

vidAT1-receptorn.TelmisartanbindsselektivttillAT

1-receptorn. Receptorbindningenärlångvarig.Telmisartan

uppvisaringenaffinitettillandrareceptorer,såsom

ochandrasämrekaraktäriseradeAT-receptorer.

Dessareceptorersfunktionellarollärintekänd,intehellereffektenaveventuellöverstimuleringavangiotensin

II,varsnivåerökarmedtelmisartan.Telmisartanledertillminskadealdosteron-nivåeriplasma.Telmisartan

hämmarintehumantplasmareninellerblockerarjonkanaler.TelmisartanhämmarinteACE(kininasII),det

enzymsomocksåbryternerbradykinin.Manförväntarsigdärförintenågonpotentieringav

bradykininmedieradebiverkningar.

80mgtelmisartantillfriskaförsökspersonerhämmarnästanfullständigtdenökningavblodtrycketsom

utlösesavangiotensinII.Hämningenvararmerän24timmarochärfortfarandemätbarupptill48timmar.

Denantihypertensivaeffekteninträdergradvisinom3timmarefterdenförstadosenavtelmisartan.Den

maximalasänkningenavblodtrycketuppnåsvanligtvis4till8veckorefterbehandlingsstartochdenbibehålles

underlångtidsbehandling.Denantihypertensivaeffektenkvarståroförändradunder24timmarefterdosering.

Dettaharvisatsmedambulatoriskablodtrycksmätningarunderdesista4timmarnaförenästados.Detta

bekräftasavmätningarsomgjortsvidpunktenförmaximaleffektochomedelbartförenästados(Detta

bekräftasävenavattkvotenmellanhögstaochlägstablodtrycksvärdeliggeröver80%efterintagav40-80

mgtelmisartaniplacebokontrolleradekliniskastudier).

Hospatientermedhypertonisänkertelmisartandetsystoliskaochdiastoliskablodtrycketutanattpåverka

hjärtfrekvensen.Denantihypertensivaeffektenavtelmisartanärjämförbarmedeffektenavandratyperav

antihypertensivaläkemedel(vilketvisatsikliniskaprövningardärtelmisartanjämförtsmedamlodipin,

atenolol,enalapril,hydroklortiazidochlisinopril).

Vidabruptutsättningavbehandlingmedtelmisartan,återgårblodtrycketgradvistillblodtrycksnivånföre

behandlingenunderfleradagar,utannågrateckenpåhastigblodtrycksstegring(”reboundhypertension”).

Incidensenavtorrhostavarsignifikantlägrehospatientersombehandlatsmedtelmisartanjämförtmeddesom

fickACE-hämmareviddirektajämförelseravdetvåantihypertensivabehandlingarikliniskastudier.

Kardiovaskulärprevention

ONTARGET(ONgoingTelmisartanAloneandinCombinationwithRamiprilGlobalEndpointTrial)

jämfördeeffektenpådetkardiovaskulärautfalletavtelmisartan,ramiprilsamtkombinationenavtelmisartan

ochramiprilhos25620patientersomvar55årelleräldremedenhistoriaavkranskärlssjukdom,stroke,TIA,

periferarteriellsjukdom,ellertyp2diabetesmellitusåtföljtavteckenpåorganskada(t.ex.retinopati,

vänsterkammarhypertrofi,makro-ellermikroalbuminuri),vilketärengruppsomlöperriskattdrabbasav

kardiovaskulärahändelser.

Läkemedelsverket2015-02-02

Patienterrandomiseradestillenavföljandetrebehandlingsgrupper:telmisartan80mg(n=8542),ramipril10

mg(n=8576),ellerkombinationenavtelmisartan80mgplusramipril10mg(n=8502),patienternaföljdes

underengenomsnittligobservationstidpå4,5år.

Telmisartanuppvisadeenliknandeeffektsomramiprilnärdetgälldereduceringavdetprimärasammansatta

effektmåttetkardiovaskulärdöd,ickefatalhjärtinfarkt,ickefatalstroke,ellersjukhusinläggningpågrundav

hjärtsvikt.Incidensenavdetprimäraeffektmåttetvarliknandeinomtelmisartan(16,7%)ochramipril(16,5

%)grupperna.Hazardratioförtelmisartanmotramiprilvar1,01(97,5%CI0,93–1,10p(non-inferiority)=

0,0019videnmarginalpå1,13).Totalmortalitetvar11,6%och11,8%hostelmisartanrespektiveramipril-

behandladepatienter.

Telmisartanvisadeliknandeeffektsomramiprilidefördefinieradesekundäraeffektmåttenkardiovaskulär

död,ickefatalhjärtinfarkt,ochickefatalstroke[0,99(97,5%CI0,90–1,08),p(non-inferiority)=0,0004],

detprimäraeffektmåttetireferensstudienHOPE(TheHeartOutcomesPreventionEvaluationStudy),som

utvärderadeeffektenavramipriljämförtmedplacebo.

ITRANSCENDrandomiseradespatientersomvarintolerantamotACE-hämmare,iövrigtmedliknandevar

inklusionskriteriersomiONTARGET,tilltelmisartan80mg(n=2954)ellerplacebo(n=2972),bådagivna

utöverstandardbehandling.Medeltidentilluppföljningvar4åroch8månader.Ingenstatistisktsignifikant

skillnadiincidensavdetprimärasammansattaeffektmåttet(kardiovaskulärdöd,ickefatalhjärtinfarkt,

ickefatalstroke,ellersjukhusinläggningpågrundavhjärtsvikt)hittades[15,7%itelmisartanoch17,0%i

placebogruppenmedhazardratiopå0,92(95%CI0,81–1,05,p=0,22)].Detfannsteckenpåennyttaav

telmisartanjämförtmedplaceboidefördefinieradesekundärasammansattaeffektmåttenkardiovaskulärdöd,

ickefatalhjärtinfarkt,ochickefatalstroke[0,87(95%CI0,76–1,00,p=0,048)].Detfannsingateckenpå

nyttamedavseendepåkardiovaskulärmortalitet(hazardratio1,03,95%CI0,85–1,24).

Hostaochangioödemrapporteradesmindrefrekventhospatientersombehandladesmedtelmisartanänhos

patientersombehandladesmedramipril,medanhypotonirapporteradesmerfrekventmedtelmisartan.

Kombinationenavtelmisartanmedramiprilgavingenytterligarenyttaframförramiprilellertelmisartangivet

ensamt.Kardiovaskulärmortalitetochtotalmortalitetvarnumeriskthögrevidkombinationsbehandling.Det

vardessutomensignifikanthögreincidensavhyperkalemi,njursvikt,hypotensionochsvimningari

kombinationsarmen.Därförrekommenderasinteanvändningenavtelmisartanochramiprilikombinationför

dennapatientgrupp.

Istudien”PreventionRegimenForEffectivelyavoidingSecondStrokes”(PRoFESS)inkluderandepatienter

50årelleräldre,somnyligengenomgåttstroke,noteradesenökadincidensavsepsismedtelmisartanjämfört

medplacebo,0,70%jämförtmed0,49%[RR1,43(96%konfidensintervall1,00–2,06)];incidensenav

fatalsepsisvarförhöjdhospatientersombehandladesmedtelmisartan(0,33%)jämförtmedpatienterpå

placebo(0,16%)[RR2,07(95%konfidensintervall1,14–3,76)].Denobserveradeökningeniförekomstav

sepsissomvarrelateradtillanvändningavtelmisartankanantingenvaraentillfällighetellerhasambandmed

enmekanismsomförnärvarandeinteärkänd.

Tvåstorarandomiserade,kontrolleradeprövningar(ONTARGET(ONgoingTelmisartanAloneandin

combinationwithRamiprilGlobalEndpointTrial)ochVANEPHRON-D(TheVeteransAffairsNephropathy

inDiabetes))harundersöktdenkombineradeanvändningenavenACE-hämmareochenangiotensinII-

receptorblockerare.

ONTARGETvarenstudiesomgenomfördespåpatientermedenanamnesavkardiovaskuläroch

cerebrovaskulärsjukdom,ellertyp2-diabetesmellitusåtföljtavevidensförslutorganskada.Förmer

detaljeradinformation,seovanunderrubrikenKardiovaskulärprevention.VANEPHRON-Dvarenstudiepå

patientermedtyp2-diabetesmellitusochdiabetesnefropati.

Dessastudierharintevisatnågonsignifikantnyttapårenalaoch/ellerkardiovaskuläraresultatochmortalitet,

medanenökadriskförhyperkalemi,akutnjurskadaoch/ellerhypotoniobserveradesjämförtmedmonoterapi.

DåderasfarmakodynamiskaegenskaperliknarvarandraärdessaresultatävenrelevantaförandraACE-

hämmareochangiotensinII-receptorblockerare.

ACE-hämmareochangiotensinII-receptorblockerarebördärförinteanvändassamtidigthospatientermed

diabetesnefropati.

ALTITUDE(AliskirenTrialinType2DiabetesUsingCardiovascularandRenalDiseaseEndpoints)varen

studiemedsyfteatttestanyttanavattläggatillaliskirentillenstandardbehandlingmedenACE-hämmare

Läkemedelsverket2015-02-02

ellerenangiotensinII-receptorblockerarehospatientermedtyp2-diabetesmellitusochkronisknjursjukdom,

kardiovaskulärsjukdomellerbådeoch.Studienavslutadesiförtideftersomdetfannsenökadriskföroönskat

utfall.Bådekardiovaskulärdödochstrokevarnumerärtvanligareialiskiren-gruppenäniplacebo-gruppen

ochoönskadehändelserochallvarligaoönskadehändelseravintresse(hyperkalemi,hypotonioch

njurdysfunktion)rapporteradesmedhögrefrekvensialiskiren-gruppenäniplacebo-gruppen.

Hydroklortiazidäretttiaziddiuretikum.Mekanismenfördenantihypertensivaeffektenavtiaziddiuretikaär

intefullständigtkänd.Tiaziderpåverkarnjurtubulisåterabsorptionavelektrolyterochökarutsöndringenav

natriumochkloridiungefärsammaomfattning.Dendiuretiskaeffektenavhydroklortiazidledertillminskad

plasmavolym,ökadplasmarenin-aktivitet,ökadaldosteronsekretion,vilketinnebärökadförlustavkaliumoch

bikarbonatiurinensamtminskatserum-kalium.Troligenpågrundavblockadavrenin-angiotensin-

aldosteronsystemet,tenderarensamtidigadministreringavtelmisartanattmotverkaförlustenavkaliumsom

förknippasmedtiaziddiuretika.Medhydroklortiazidskeruppkomstenavdiureseninom2timmar,med

maximaleffektpåca4timmar,effektenvararica6-12timmar.Epidemiologiskastudierharvisatatt

långtidsbehandlingmedhydroklortiazidminskarriskenförkardiovaskulärmortalitetochmorbiditet.

Effektenavdenfastakombinationentelmisartan/hydroklortiazidpåmortalitetochkardiovaskulärmorbiditet

ärförnärvarandeintekänd.

5.2 Farmakokinetiskaegenskaper

Samtidigadministreringavhydroklortiazidochtelmisartanförefallerintepåverkafarmakokinetikenavendera

substansenhosfriskaförsökspersoner.

Absorption:

Telmisartan:Efteroraltillförseluppnåsmaximalplasmakoncentrationavtelmisartaninom0,5-1,5timme

efterdosering.Denabsolutabiotillgänglighetenförtelmisartan40mgrespektive160mgvar42%respektive

58%.Närtelmisartanintasmedfödaminskarbiotillgänglighetenmedenminskningavytanunder

plasmakoncentration-tidkurvan(AUC)medca6%med40mgtelmisartanochmedca19%meddosen160

mg.Tretimmarefterdoseringärplasmakoncentrationenlikartadvaresigtelmisartanintagitsmedellerutan

föda.DenlillaminskningenavAUCförväntasinteledatillenminskadterapeutiskeffekt.Farmakokinetiken

avoralttillförttelmisartanäricke-linjäridosintervallet20-160mgmedmeränproportionellaökningarav

plasmakoncentration(CmaxochAUC)medökandedos.Telmisartanackumulerasintesignifikantiplasmavid

upprepadtillförsel.

Hydroklortiazid:EfteroraltillförselavTelmisartan/Hydrochlorothiazideuppnåsmaximal

plasmakoncentrationavtelmisartaninom1,0-3,0timmarefterdosering.Baseratpådenkumulativarenala

utsöndringenavhydroklortiazidvardenabsolutabiotillgänglighetenca60%.

Distribution:

Telmisartanärhöggradigtbundettillplasmaproteiner(>99,5%)framföralltalbuminochalfa-l-glykoprotein.

Distributionsvolymenförtelmisartanärungefär500liter,vilkettyderpåatttelmisartanocksåbindertill

vävnaderna.

Hydroklortiazidärproteinbundettill68%ochdistributionsvolymenär0,83-1,14l/kg.

Metabolism

Telmisartanmetaboliserasgenomkonjugeringtillfarmakologisktinaktivacylglukuronid.Glukuronidav

modersubstansenärdenendametabolitsomharidentifieratshosmänniska.Efterenengångsdosav14C-

märkttelmisartanrepresenterarglukuroniden11%avradioaktiviteteniplasma.CytokromP450isoenzymer

deltarinteimetaboliseringenavtelmisartan.

Hydroklortiazidmetaboliserasintehosmänniska.

Eliminering

Telmisartan:Efteroralellerintravenöstillförselav14C-märkttelmisartaneliminerashuvuddelenavdosen(>

97%)ifaeces,viabiliärutsöndring.Endastobetydligamängderåterfannsiurin.Totalplasma-clearanceav

telmisartanefteroraltillförselär>1500ml/min.

Terminalhalveringstidvar>20timmar.

Läkemedelsverket2015-02-02

Hydroklortiazidutsöndrasihuvudsaksomoförändradsubstansiurinen.Ca60%avdenoraladosen

eliminerasinom48timmar.Renaltclearanceärca250-300ml/min.Denterminala

eliminationshalveringstidenförhydroklortiazidär10-15timmar.

Särskildapatientgrupper

Äldre

Farmakokinetikenförtelmisartanskiljersiginteåthosäldreochpatienterunder65år.

Kön

Plasmakoncentrationenavtelmisartanärungefär2-3gångerhögrehoskvinnoränhosmän.Ikliniskastudier

fannmandockintenågonsignifikantskillnadiblodtryckssvarellerincidensavortostatiskhypotensionhos

kvinnor.Ingendosjusteringärnödvändig.Detfinnsentrendtillhögreplasmakoncentrationerav

hydroklortiazidhoskvinnoränhosmän.Dettaansesintehakliniskrelevans.

Nedsattnjurfunktion:

Renalutsöndringbidrarintetillclearanceavtelmisartan.Baseratpåbegränsaderfarenhetavpatientermed

mildtillmåttlignedsättningavnjurfunktionen(kreatinin-clearance30-60ml/min,genomsnittsvärdeca50

ml/min)ärdetintenödvändigtmeddosjusteringtillpatientermednedsattnjurfunktion.Telmisartan

eliminerasintefrånblodetviahemodialys.Hospatientermednedsattnjurfunktionärhydroklortiazid-

eliminationenshastighetreducerad.Ientypiskstudiemedpatientermedgenomsnittligtkreatininclearancepå

90ml/minökadeeliminationshalveringstidenförhydroklortiazid.Hospatienterutanegennjurfunktionvar

halveringstidenföreliminationenca34timmar.

Nedsattleverfunktion:

Ifarmakokinetiskastudieravpatientermednedsattleverfunktionsågsenökningavabsolutbiotillgänglighet

upptillnästan100%.Halveringstidenföreliminationsfasenäroförändradhospatientermedleverinsufficiens.

5.3 Prekliniskasäkerhetsuppgifter

Iprekliniskasäkerhetsstudierdärtelmisartanochhydroklortiazidsamtidigttillfördestillnormotensivaråttor

ochhundar,hadedoserjämförbarameddenkliniskadoseningaytterligareeffekter,jämförtmeddesom

observeratsmedenderasubstansenenskilt.Detoxikologiskafyndsomharobserveratsharingenrelevansför

behandlingavmänniskor.

FöljandetoxikologiskafyndärvälkändafrånprekliniskastudiermedACE-hämmareochangiotensinII-

antagonister:minskningavrödablodkroppsparametrar(erytrocyter,hemoglobin,hematokrit),förändringari

renalhemodynamik(ökatblodureaochkreatinin),ökadreninaktivitetiplasma,hypertrofi/hyperplasiide

juxtaglomeruläracellernaochgastrointestinalaskador.Gastrointestinalasårkundemotverkas/förbättras

genomtilläggavoraltgivenkoksaltlösningochgemensammaburar.Hoshundsågsdilatationochatrofiav

renalatubuli.Dessafyndansesberopåtelmisartansfarmakologiskaaktivitet.

Ingatydligabevispåteratogeneffektharobserverats,menvidtoxiskadosnivåeravtelmisartanobserverades

eneffektpådenpostnatalautvecklingenhosavkommansåsomlägrekroppsviktochfördröjningtillattöppna

ögonen.

Telmisartanvisadeingateckenpåmutagenicitetellerrelevantklastogenaktivitetiinvitrostudierochinga

teckenpåcarcinogenicitethosråttaochmus.Studiermedhydroklortiazidharvisatpåengenotoxiskeller

carcinogeneffektivissaexperimentellamodeller.Omfattandekliniskerfarenhethardockintekunnatpåvisa

någotsambandmellanbehandlingmedhydroklortiazidochtumörsjukdom.

Förfostertoxiskaeffekteravkombinationentelmisartan/hydroklortiazid,seavsnitt4.6.

6. FARMACEUTISKAEGENSKAPER

6.1 Förteckningöverhjälpämnen

Läkemedelsverket2015-02-02

Krospovidon

Hypromellos

Laktosmonohydrat

Magnesiumstearat

Mannitol

Meglumin

Povidon

Vattenfrikolloidalkiseldioxid

Natriumhydroxid

Natriumstearylfumarat

Talk

Rödjärnoxid(E172)

6.2 Inkompatibiliteter

Ejtillämpligt.

6.3 Hållbarhet

3år

6.4 Särskildaförvaringsanvisningar

Förvarasioriginalförpackningen.Fuktkänsligt.

6.5 Förpackningstypochinnehåll

Aluminium-aluminiumblisterförpackningarförpackadeikartongerinnehållande14,28,30,56,90eller98

tabletter.

Eventuelltkommerinteallaförpackningsstorlekarattmarknadsföras.

6.6 Särskildaanvisningarfördestruktion

Ejanväntläkemedelochavfallskakasserasenligtgällandeanvisningar.

7. INNEHAVARENAVGODKÄNNANDETFÖRFÖRSÄLJNING

GlenmarkPharmaceuticalsEuropeLimited

LaxmiHouse,2BDraycottAvenue,

Kenton,Middlesex,HA30BU.

Storbritannien

8. NUMMERPÅGODKÄNNANDEFÖRFÖRSÄLJNING

49100

9. DATUMFÖRFÖRSTAGODKÄNNANDE/FÖRNYATGODKÄNNANDE

2014-04-24/

10. DATUMFÖRÖVERSYNAVPRODUKTRESUMEN

2015-02-02

Liknande Produkter

Sök varningar relaterade till denna produkt

Visa dokumenthistorik

Dela den här informationen