Topiramat Premier Research 25 mg Filmtabletten

Deutschland - Deutsch - BfArM (Bundesinstitut für Arzneimittel und Medizinprodukte)

Kaufe es jetzt

Gebrauchsinformation PIL
Fachinformation SPC
Wirkstoff:
Topiramat
Verfügbar ab:
Mylan dura GmbH
INN (Internationale Bezeichnung):
Topiramate
Darreichungsform:
Filmtablette
Zusammensetzung:
Topiramat 25.mg
Berechtigungsstatus:
gültig
Zulassungsnummer:
66072.00.00

TopiramatPremierResearch25mgFilmtabletten ENR2165072

Gebrauchsinformation:InformationfürdenAnwender

TopiramatPremierResearch25mgFilmtabletten

Wirkstoff:Topiramat

LesenSiediegesamtePackungsbeilagesorgfältigdurch,bevorSiemitderEinnahme

diesesArzneimittelsbeginnen.

·HebenSiediePackungsbeilageauf.VielleichtmöchtenSiediesespäternochmalslesen.

·WennSieweitereFragenhaben,wendenSiesichanIhrenArztoderApotheker.

·DiesesArzneimittelwurdeIhnenpersönlichverschrieben.GebenSieesnichtanDritte

weiter.EskannanderenMenschenschaden,auchwenndiesedieselbenSymptome

habenwieSie.

·WenneinederaufgeführtenNebenwirkungenSieerheblichbeeinträchtigtoderSie

Nebenwirkungenbemerken,dienichtindieserGebrauchsinformationangegebensind,

informierenSiebitteIhrenArztoderApotheker.

DiesePackungsbeilagebeinhaltet:

WasistTopiramatPremierResearch25mgundwofürwirdesangewendet?

WasmüssenSievorderEinnahmevonTopiramatPremierResearch25mg

beachten?

WieistTopiramatPremierResearch25mgeinzunehmen?

WelcheNebenwirkungensindmöglich?

WieistTopiramatPremierResearch25mgaufzubewahren?

WeitereInformationen

1.WASISTTOPIRAMATPREMIERRESEARCH25MGUNDWOFÜRWIRDES

ANGEWENDET?

TopiramatPremierResearch25mgisteinArzneimittelzurBehandlungderEpilepsieundzur

vorbeugendenBehandlungvonMigräne-Kopfschmerzen,alsMittel2.Wahl.

TopiramatPremierResearch25mgwirdangewendetbei:

Epilepsie:

·zurMonotherapie(d.h.eineBehandlungausschließlichmitTopiramatPremierResearch

25mg)beiErwachsenenundKindernab2JahrenmitneudiagnostizierterEpilepsie

oderzurUmstellungaufeineMonotherapie;

·zurZusatztherapie(zusammenmitanderenArzneimittelngegenEpilepsie)bei

ErwachsenenundKindernab2Jahrenmit:

-fokalenepileptischenAnfällenmitoderohnesekundärerGeneralisierung,

-primärgeneralisiertentonisch-klonischenAnfällenund

-epileptischenAnfällenbeimLennox-Gastaut-Syndrom.

Migräne-Prophylaxe:

·zurVorbeugung(Prophylaxe)vonMigräne-KopfschmerzenbeiErwachsenen,alsMittel

der2.Wahl.

TopiramatPremierResearch25mgFilmtabletten ENR2165072

2.WASMÜSSENSIEVORDEREINNAHMEVONTOPIRAMATPREMIERRESEARCH

25MGBEACHTEN?

TopiramatPremierResearch25mgdarfnichteingenommenwerden,

wennSieüberempfindlich(allergisch)gegenüberTopiramatodereinendersonstigen

BestandteilevonTopiramatPremierResearch25mgsind.

wennSieschwangersindundTopiramatalsMigräneprophylaxeeinnehmen(siehe

unterAbschnitt2.SchwangerschaftundStillzeit).

BesondereVorsichtbeiderEinnahmevonTopiramatPremierResearch25mgist

erforderlich,

wennSieschwangersindundTopiramatimRahmenderantiepileptischen

Behandlungeinnehmen(sieheunterAbschnitt2.SchwangerschaftundStillzeit)Wenn

SieanEpilepsieleiden,solltenSiemitIhremArztüberdasRisikofürdasungeborene

Kindundggf.einealternativeTherapiesprechen.

wennSieaneinerNieren-oderLebererkrankungleiden(IhrArztmussIhnen

gegebenenfallseineniedrigereTopiramat-Dosisverschreiben).

wennSieodereinFamilienangehörigeranNierensteinenleiden.Topiramatkanndie

Wahrscheinlichkeit,dassNierensteineentstehen,erhöhen.WennSieNierenschmerzen

oderSchmerzenimunterenRückenhaben,suchenSiebitteumgehendIhrenArztauf.

AußerdemsolltenwährendderAnwendungvonTopiramatPremierResearch25mg

andereArzneimittel,diezuNierensteinenführensowieeinefettreicheund

kohlenhydratarmeDiätvermiedenwerden.

beiunerwünschtemGewichtsverlust.WendenSiesichbitteanIhrenArztund

besprechenSiemitihm,wasSietunsollen.

wenneswährendderBehandlungzuAugenschmerzenoderSchleiersehenkommt.

InformierenSieindiesemFallumgehendIhrenArzt,denneskannsichmöglicherweise

umSymptomehandeln,diedurchTopiramatPremierResearch25mghervorgerufen

werdenundmiteinemAnstiegdesAugeninnendrucksverbundensind(Glaukombzw.

grünerStar).

wennDepressionenundStimmungsschwankungenauftreten.WennSiebeisich

irgendwanneineDepressionfeststellenoderdarandenken,sichdasLebenzunehmen,

gehenSiezuIhremArzt.Eskannhilfreichsein,wennSieeinemFreundoder

Verwandtenerzählen,dassSiedepressivsindoderuntereinerAngststörungleiden.

BittenSiediesePersonen,diesePackungsbeilagezulesen.

InformierenSieumgehendIhrenArzt,wennesbeiIhremKindzuSuizidgedanken

(Selbsttötungsgedanken)kommt

SowohlbeiPatientenmitalsauchohneausderVorgeschichtebekanntenKrampfanfällen

undEpilepsiesolltenAntiepileptikaeinschließlichTopiramatschrittweisereduziertwerden,

umdasRisikovonKrampfanfällenodereinesAnstiegsderAnfallsfrequenzzuverringern.In

Situationen,woeinschnellesAbsetzenvonTopiramatmedizinischindiziertist,wirdeine

geeigneteÜberwachungempfohlen.

MetabolischeAzidose(stoffwechselbedingteÜbersäuerung):

TopiramatPremierResearch25mgkanndenBicarbonatspiegelimBlutsenken,waseinen

Zustand,bekanntalsmetabolischeAzidose,hervorruft.DiesistzuBeginnderBehandlung

sowiezujedemBehandlungszeitpunktmöglich.

BedingungenoderTherapien,diedieAusbildungeinerAzidosebegünstigensind

TopiramatPremierResearch25mgFilmtabletten ENR2165072

Nierenerkrankungen,schwereErkrankungendesAtmungssystems,epileptischeAnfälle,die

längerals30Minutenandauern(Statusepilepticus),Durchfallodervorkurzemdurchgeführte

chirurgischeEingriffe.Beieinerfett-oderproteinreichenDiätoderwennSiebestimmte

andereArzneimitteleinnehmen,istebenfallsdasRisiko,einemetabolischeAzidosezu

entwickeln,erhöht.

EinechronischemetabolischeAzidoseerhöhtdasRisikoderNierensteinbildungundkann

beiKindernzueinerRachitisführenunddasWachstumverlangsamen.IhrArztwird

gegebenenfallsdieDosisverringernoderTopiramatPremierResearch25mgdurch

langsameVerringerungderDosisabsetzen.

AusreichendeFlüssigkeitszufuhr:

EineausreichendeTrinkmengeunterderBehandlungmitTopiramatistsehrwichtig.Diese

kanndasRisikoeinerNierensteinbildungvermindern(sieheoben).Topiramatkannvorallem

beiKinderndasSchwitzenverringern,undzueinemAnstiegderKörpertemperaturbei

sportlichenAktivitätenundAufenthaltinwarmerUmgebungführen.Eineausreichende

TrinkmengevorundwährendAktivitätenwieSportoderSituationen,beidenenSiesich

warmenTemperaturenaussetzen,kanndasRisikohitzebedingterNebenwirkungenwie

KopfschmerzenundÜbelkeitvermindern(sieheAbschnitt4.„WelcheNebenwirkungensind

möglich").

KinderundJugendliche:

Epilepsiebehandlung:

DiesesArzneimittelistnichtfürdieAnwendungbeiKindernunter2Jahrenbestimmt,dafür

dieseAltersgruppenochkeineausreichendenklinischenErfahrungenvorliegen.

Migräneprophylaxe:

DiesesArzneimittelistnichtfürdieAnwendungbeiKindernundJugendlichenbestimmt,da

fürdieseAltersgruppeinderMigräneprophylaxenochkeineausreichendenklinischen

Erfahrungenvorliegen.

BeiEinnahmevonTopiramatPremierResearch25mgmitanderenArzneimitteln:

BitteinformierenSieIhrenArztoderApotheker,wennSieandereArzneimittel

einnehmen/anwendenbzw.vorkurzemeingenommen/angewendethaben,auchwennes

sichumnichtverschreibungspflichtigeArzneimittelhandelt.

TopiramatkanndieWirkungandererArzneimittelundandereArzneimittelkönnendie

WirkungvonTopiramatbeeinflussen,wennsiegleichzeitigangewendetwerden.

InformierenSieIhrenArztinsbesonderedann,wennSieeinesderfolgendenArzneimittel

einnehmen:

PhenytoinoderCarbamazepin(zurBehandlungderEpilepsie),weilIhrArztunter

UmständendieDosisdieserArzneimitteloderIhreTopiramat-Dosisanpassenmuss.

Digoxin(zurBehandlungvonHerzerkrankungen),weilIhrArztunterUmständenIhre

Digoxin-Dosisanpassenmuss.

Diltiazem(zurBehandlungvonBluthochdruckundBrustschmerzinfolgeeinerAngina

pectoris),weilIhrArztunterUmständenIhreTopiramat-Dosisanpassenmuss.

Metformin,GlibenclamidoderPioglitazon(zurBehandlungdesDiabetes),weilIhrArzt

IhrenDiabetesüberwachenmöchte.

Hydrochlorothiazid(HCTZ)(Wassertabletten),weilIhrArztunterUmständenIhre

Topiramat-Dosisanpassenmuss.

TopiramatPremierResearch25mgFilmtabletten ENR2165072

HormonaleEmpfängnisverhütungsmittel(Anti-Baby-Pille):WennSieestrogenhaltige

Verhütungsmitteleinnehmen,solltenSieIhremArztjedeVeränderungIhrer

Monatsblutungmitteilen.

DerEinflussaufhormonaleEmpfängnisverhütungsmittelwurdeinklinischenStudiengeprüft.

HierbeiergabsichinallengeprüftenDosierungenkeinEinflussaufdie

Gestagenkomponente;einEinflussaufdieEstrogenkomponentewurdeinDosierungenab

200mgTopiramatproTaginKombinationmitValproinsäurebeobachtet.Dahersolltedie

MöglichkeiteinervermindertenempfängnisverhütendenWirksamkeitunddasAuftretenvon

Durchbruchblutungenbeachtetwerden.DieempfängnisverhütendeWirksamkeitkannauch

vermindertsein,wennkeineDurchbruchblutungenauftreten.

Lithium(zurBehandlungmanischerDepressionen):WennSieeineLithiumtherapie

erhaltenundgleichzeitigTopiramateinnehmen,solltendieLithiumspiegelüberwacht

werden.

Glibenclamid(zurBehandlungdesDiabetes):WirdTopiramatbeiPatientenuntereiner

Glibenclamid-Therapieneueingesetztoderabgesetzt,solltensorgfältige

RoutineuntersuchungenbeiBlutzuckerkrankheitdurchgeführtwerden,dader

GlibenclamidspiegelbeigleichzeitigerTherapiemitTopiramatvermindertseinkann,

wodurchdieBlutzuckerspiegelansteigenkönnen.

Arzneimittel,dieeineNierensteinbildungfördern,könnenzueinemerhöhten

Nierensteinrisikoführen.DiegleichzeitigeEinnahmesolcherMittel,insbesonderevon

Acetazolamid,Triamteren,ZonisamidundVitaminCinMengenüber2g/Tag,solltedaher

vermiedenwerden.

Valproinsäure ( zurBehandlungderEpilepsie),weildiegleichzeitigeGabevonTopiramat

undValproinsäuremiteinembestimmtenerhöhtenBlutwert(Ammoniak)mitundohne

begleitendeGehirnfunktionsstörungbeiPatienteninVerbindunggebrachtwurde.

Zonisamid,weildiegleichzeitigeEinnahmevonCarboanhydrase-Inhibitorenwiez.B.

Sultiam,Zonisamid(einebestimmteArzneimittelgruppeu.a.zurEpilepsiebehandlung)

möglicherweiseNebenwirkungen,diedurchdieHemmungdesEnzymsCarboanhydrase

bedingtsind,verstärkenkann.

Flunarizin,Diltiazem,Amitryptilin,Haloperidol,Diltiazem,Propranolol,weilsiedurch

TopiramatinihrerWirkungbeeinflussenkönnen.PropranololundDiltiazemerhöhenden

PlasmaspiegelvonTopiramat.

BeiEinnahmevonTopiramatPremierResearch25mgzusammenmit

NahrungsmittelnundGetränken

TopiramatPremierResearch25mgkannzuoderunabhängigvondenMahlzeitenmiteiner

ausreichendenMengeanFlüssigkeiteingenommenwerden.BeiAlkoholgenusswährendder

TherapiemitTopiramat,kanndieWirkungvonTopiramataufIhrNervensystemverstärkt

werden.DeshalbsolltewährendderBehandlungvonAlkoholgenussabgesehenwerden.

SchwangerschaftundStillzeit

FragenSievorderEinnahme/AnwendungvonallenArzneimittelnIhrenArztoderApotheker

umRat.

Schwangerschaft

BeiderEinnahmevonTopiramatwährendderSchwangerschaftmusswiebeianderen

MedikamentendieserWirkstoffklassemiteinemerhöhtenFehlbildungsrisikofürdas

ungeboreneKindgerechnetwerden.

TopiramatPremierResearch25mgFilmtabletten ENR2165072

DeshalbgiltfolgendeRegelungfürdiebeidenAnwendungsgebietevonTopiramat

MigräneprophylaxeundEpilepsie:

Migräneprophylaxe:

DafürdieMigräneprophylaxealternativeTherapienzurVerfügungstehen,dürfenSie

TopiramatinderSchwangerschaftnichteinnehmen.WennSieimgebärfähigenAlter

sind,solltenSiewährendEinnahmevonTopiramateinezuverlässigeMethodezur

Empfängnisverhütunganwenden.BittebesprechenSiediesunbedingtmitIhremArzt.

AntiepileptischeTherapie:

WennSieimgebärfähigenAlteroderbesonders,wennSieschwangersind,dürfenSie

Topiramat,denWirkstoffvonTopiramatPremierResearch25mg,nureinnehmen,wennIhr

ArztdiesfürzwingenderforderlichhältundkeineTherapiealternativenzurVerfügungstehen.

WennSieeineSchwangerschaftplanenoderbeiIhnenuntereinerBehandlungmit

TopiramateineSchwangerschafteintrittoderwenndieBehandlungmitTopiramatinder

Schwangerschafterforderlichist,mussIhrArztdieNotwendigkeiteinerAnfallskontrolle

sorgfältiggegendasmöglicheRisikofürdasKindabwägen.WährendderSchwangerschaft

sollteTopiramatmöglichstalsMonotherapieundinderniedrigstenwirksamenDosis

eingenommenwerden.InkeinemFalldürfenSiedieEinnahmeohneärztlichenRat

abbrechen,daesbeiepileptischenAnfällenzurSchädigungdesKindeskommenkann.

VorgeburtlicheMassnahmenzurFrüherkennungvonSchädigungen(Ultraschallund

BestimmungvonAlphafetoprotein)werdenzurReduzierungdesRisikosempfohlen.

Stillzeit

DaTopiramat,derWirkstoffausTopiramat,indieMuttermilchübergehtundNebenwirkungen

fürdenSäuglingnichtausgeschlossenwerdenkönnen,sollenSieTopiramatwährendder

Stillzeitnichteinnehmen.HältIhrArzteineTherapiemitTopiramatinderStillzeitfür

zwingenderforderlich,müssenSieabstillen.

VerkehrstüchtigkeitunddasBedienenvonMaschinen:

TopiramatPremierResearch25mgFilmtablettenkönnenauchbeibestimmungsgemäßem

GebrauchundbesondersinderAnfangsphasederTherapieSchwindel,Schläfrigkeitund

ähnlicheSymptomeverursachen.DieFähigkeitzurTeilnahmeamStraßenverkehroderzum

BedienenvonMaschinenkanndadurchbeeinträchtigtwerden.DiesgiltinverstärktemMaße

imZusammenwirkenmitAlkohol.

3.WIEISTTOPIRAMATPREMIERRESEARCH25MGEINZUNEHMEN?

NehmenSieTopiramatPremierResearch25mgimmergenaunachderAnweisungdes

Arztesein.BittefragenSiebeiIhremArztoderApothekernach,wennSiesichnichtganz

sichersind.

FallsvomArztnichtandersverordnet,wirddieTherapiemiteinerniedrigenDosisbegonnen

undbiszueinerwirksamenZieldosisgesteigert.HierfürstehenweitereStärkenzur

Verfügung.

TopiramatPremierResearch25mgsollteaufzweiEinzelgabenverteilt(morgensund

abends)eingenommenwerden.BeieinigenPatientenistauchdieEinmalgabemöglich.

Dosierung,wennSienurTopiramatPremierResearch25mgzurBehandlungder

Epilepsieeinnehmen

fürErwachseneundJugendlicheab12Jahren:

TopiramatPremierResearch25mgFilmtabletten ENR2165072

IhrArztwirddieBehandlungmiteinerDosisvon25mgproTagbeginnen,dieüber7Tage

langamAbendeinzunehmenist.DanachwirderdieDosisum

25-50mgalle7bis14TageerhöhenbisIhreEpilepsieunterKontrolleist.IhrArztwird

Ihnensagen,welcheDosiseinzunehmenist.

DieüblicheDosisbeiErwachsenenundJugendlichenab12Jahrenbeträgt

50mgzweimalproTag.IhrArztkannaberaucheinehöhereoderniedrigereDosis

anordnen.DieempfohlenemaximaleTagesdosisbeträgt500mg.

FürKinder2Jahreoderälter:

DieEindosierungsollteindererstenWochemit0,5-1mg/kgKörpergewicht/Tagabends

beginnen.AnschließendsolltedieDosisalle1-2Wochenum0,5-1mg/kgKörpergewicht/Tag

gesteigertwerden.

DieanfänglichempfohleneZieldosisfürKinderab2Jahrenbeträgt3-6mg/kg

Körpergewicht/Tag,wennmitTopiramatalleinebehandeltwird.

Dosierung,wennSieTopiramatPremierResearch25mgzusammenmitanderen

AntiepileptikazurBehandlungderEpilepsieeinnehmen

fürErwachseneundJugendlicheab12Jahren:

IhrArztwirddieBehandlungmiteinerDosisvon25-50mgproTagbeginnen,dieüber7

TagelangamAbendeinzunehmenist.DanachwirderdieDosisum

25-50mgalle7bis14TageerhöhenbisIhreEpilepsieunterKontrolleist.IhrArztwird

Ihnensagen,welcheDosiseinzunehmenist.

DieüblicheDosisbeiErwachsenenundJugendlichenab12Jahrenbeträgtzweimaltäglich

100-200mg.IhrArztkannaberaucheinehöhereoderniedrigereDosisanordnen.Die

empfohlenemaximaleTagesdosisbeträgt

800mg.

FürKinder2Jahreoderälter:

DieempfohleneDosisbeträgtfürKinderab2Jahren5bis9mg/kgKörpergewicht/Tag.In

dererstenWochesolltedieEindosierungmit25mgTopiramat/Tagabendsbeginnen(oder

weniger,demKörpergewichtentsprechendineinemDosierungsbereichzwischen0,5und1

mg/kgKörpergewicht/Tag).AnschließendsolltedieDosisalle1-2Wochenumca.1mg/kg

Körpergewicht/Taggesteigertwerden.

Tagesdosenbiszu30mg/kgKörpergewicht/TagwurdenuntersuchtundimAllgemeinengut

vertragen.

Dosierung,wennSieTopiramatPremierResearch25mgzurVorbeugungvon

Migränekopfschmerzeneinnehmen:

IhrArztwirddieBehandlungmiteinerDosisvon25mgproTagbeginnen,dieüber7Tage

langamAbendeinzunehmenist.AnschließendsollteinwöchentlichenAbständendie

Tagesdosisum25mggesteigertwerden(1.Woche:25mg/Tag,2.Woche50mg/Tag

usw.).FallsSiediesesEindosierungsschemanichtvertragen,könnenlängereIntervalle

zwischendenDosisanpassungengewähltwerden.

DieempfohleneGesamttagesdosisbeträgt2maltäglich50mg.HöhereDosenführtennicht

zueinemgrößerenNutzen.EinigePatientenkönnenbeieinerGesamttagesdosisvon50

mg/TagbereitseinenNutzenerfahren.

TopiramatPremierResearch25mgFilmtabletten ENR2165072

BehandlungderEpilepsieundMigräne-ProphylaxebeiPatientenunterHämodialyse

(Blutwäsche):

DaTopiramatdurchBlutwäsche(Hämodialyse)ausdemBlutplasmaentferntwird,istes

notwendig,beiHämodialyse-PatientenamTagderDialysedieDosisumca.dieHälftezu

erhöhen.DieseErhöhungsollteaufzweiDosenverteiltwerden:unmittelbarvorundbei

BeendigungderDialyse.DiezusätzlichbenötigteDosiskannvonderverwendeten

Dialysemethodebzw.demDialysegerätabhängigsein.

ArtderAnwendung:

DieTablettensolltenmöglichstjedenTagzurselbenZeiteingenommenwerden.EinTeilder

TagesdosissolltemorgensundderRestamAbendeingenommenwerdenNehmenSiebitte

TopiramatPremierResearch25mgganz,unzerkautundmitausreichendFlüssigkeitein.Die

EinnahmekannunabhängigvondenMahlzeitenerfolgen.

BittesprechenSiemitIhremArztoderApotheker,wennSiedenEindruckhaben,dassdie

WirkungvonTopiramatPremierResearch25mgzustarkoderzuschwachist.

WennSieeinegrößereMengeTopiramatPremierResearch25mgeingenommenhaben

alsSiesollten

WendenSiesichumgehendanIhrenArztoderdieNotaufnahmedesnächstgelegenen

Krankenhauses.NehmenSiediePackungundverbliebeneTablettenmit.Anzeichenund

SymptomeeinerÜberdosierungvonTopiramatPremierResearch25mgsind:

Schläfrigkeit,Sprachstörungen,Schleiersehen,Doppeltsehen,Konzentrationsstörungen,

MüdigkeitundAntriebsmangel,mangelndeAnsprechbarkeit,niedrigerBlutdruck,

Bauchschmerzen,Kopfschmerzen,körperlicheUnruhe,Schwindel,

Koordinationsstörungen,DepressionenundKrampfanfällesowieBlutbildveränderungen.

WennSiedieEinnahmevonTopiramatPremierResearch25mgvergessenhaben

WennSieeineEinnahmeversäumen,holenSiediesesobaldwiemöglichnach,essei

denn,esistbeinaheZeitfürdienächsteEinnahme.HolenSiedieversäumteEinnahmein

diesemFallnichtnach,sondernsetzenSiedieEinnahmewiegewohntfort.NehmenSie

nichtdiedoppelteDosisein,wennSiedievorherigeEinnahmevergessenhaben.

WennSiedieEinnahmevonTopiramatPremierResearch25mgabbrechen

TopiramatPremierResearch25mgwurdeIhnenverschrieben,umIhreEpilepsiezu

kontrollierenoderdemWiederauftretenvonMigränekopfschmerzenvorzubeugen.Sie

dürfendieEinnahmenichtabruptabbrechen.SprechenSievorhermitIhremArzt,wenn

SiedieBehandlungabsetzenmöchten.WennSiedieEinnahmevonTopiramatPremier

Research25mgbeendenmüssen,wirdIhrArztdieDosisschrittweiseverringern,umso

dasRisikofürdasAuftreteneinesepileptischenAnfallsodereinesMigräneanfallszu

verringern.

WennSieweitereFragenzurAnwendungdesArzneimittelshaben,fragenSieIhrenArzt

oderApotheker.

TopiramatPremierResearch25mgFilmtabletten ENR2165072

4. WELCHENEBENWIRKUNGENSINDMÖGLICH?

WiealleArzneimittelkannTopiramatPremierResearch25mgNebenwirkungenhaben,die

abernichtbeijedemauftretenmüssen.

NebenwirkungenvonTopiramatPremierResearch25mgkönneninsbesonderezuBeginn

derBehandlungoderwährendderAnpassungderDosisauftreten.DieNebenwirkungensind

häufigleichtausgeprägtundverschwindenunterfortgesetzterTherapie.

BeiderBewertungvonNebenwirkungenwerdenfolgendeHäufigkeitsangabenzugrunde

gelegt:

Sehrhäufig:mehrals1von10Behandelten

Häufig: wenigerals1von10,abermehrals1von100

Behandelten

Gelegentlich:wenigerals1von100,abermehrals1von1000

Behandelten

Selten: wenigerals1von1000,abermehrals1von10000

Behandelten

Sehrselten:wenigerals1von10000Behandelten,einschließlich

Einzelfälle

AllgemeineErkrankungenundBeschwerdenamVerabreichungsort

Sehrhäufig:Schwindel,Müdigkeit,Schläfrigkeit,Nervosität,Kopfschmerzen,Übelkeit.

Häufig:Knochenschmerzen,allergischeReaktionen,Schlaflosigkeit(Unfähigkeit,

einzuschlafen).

Stoffwechsel-undErnährungsstörungen

Sehrhäufig:Gewichtsabnahme.

Häufig:MetabolischeAzidose.

ErkrankungendesBlutesunddesLymphsystems

Häufig:Anämie(VerminderungderrotenBlutkörperchen,wodurcheszuBlässederHaut

undSchwächeoderAtemlosigkeitkommenkann),Nasenbluten,Purpura(flächenhafte

Hautblutungen),Leukopenie(ungewöhnlichniedrigeZahlanweißenBlutkörperchen),

Thrombozytopenie(ungewöhnlichniedrigeZahlanBlutplättchen).

Selten:Neutropenie(niedrigeZahleinerbestimmtenArtvonweißenBlutkörperchen,die

neutrophileGranulozytengenanntwerden).

PsychiatrischeErkrankungen

Sehrhäufig:Gedächtnisstörungen,Anorexie(Appetitverlust),Verwirrtheitund

psychomotorischeVerlangsamung,Depression,Konzentrationsstörungen,Angst.

Häufig:Apathie,Asthenie(Schwäche),Euphorie,emotionaleEmpfindlichkeit,

Ruhelosigkeit,kognitiveProbleme,vermindertessexuellesVerlangen,aggressive

Reaktionen,PsychosenoderpsychotischeSymptome.

Gelegentlich:Halluzinationen,Persönlichkeitsstörungen,Suizidgedanken,Suizidversuche.

ErkrankungenderAtemwege,desBrustraumsundMediastinums

Gelegentlich:Dyspnoe(Atemprobleme).

ErkrankungendesMagen-Darm-Trakts

Häufig:Verstopfung,Bauchschmerzen.

TopiramatPremierResearch25mgFilmtabletten ENR2165072

Gelegentlich:Durchfall,ErbrechenundMundtrockenheit.

ErkrankungenderHautunddesUnterhautzellgewebes

Häufig:Haarausfall.

Gelegentlich:Follikulitis(InfektioneinerHaarwurzel)undPruritus(Juckreiz).

ErkrankungenderNierenundHarnwege

Häufig:Harninkontinenz,Nierensteine.

ErkrankungendesNervensystems

Sehrhäufig:Ataxie(unsichereBewegungen),Parästhesien(ungewöhnlicheEmpfindungen

aufderHaut),Sprachstörungen,Aphasie(Sprachverlust).

Häufig:Tremor,Koordinationsstörungen,Gangstörungen,Nystagmus(nichtbeabsichtigte

BewegungenderAugen),Geschmacksveränderung.

Gelegentlich:Hypokinesie(ungewöhnlichverminderteMuskelbewegungen),Stupor(Fälle

vonkörperlicherVersteifungbeiBewusstsein).

Leber-undGallenerkrankungen

Selten:AnstiegderLeberenzyme.

Augenerkrankungen

Sehrhäufig:Doppeltsehen,Sehstörungen.

Selten:AkuteMyopie(akuteKurzsichtigkeit)aufgrundeinesGlaukoms,Augen-schmerzen.

ErkrankungenderGeschlechtsorganeundderBrustdrüse

Häufig:Menstruationsstörungen,Impotenz.

ZudenSymptomeneinerakutenMyopieundeinessekundärenEngwinkelglaukoms

gehören(beiErwachsenen,JugendlichenundKindern)eineakuteVerringerungder

Sehschärfeund/oderAugenschmerzen,dietypischerweiseinnerhalbvon1Monatnach

BeginnderTopiramat-Therapieauftreten.

EsliegeneinzelneBerichteüberdasAuftretenvonHautausschlägenundBlasenimBereich

derHautsowieSchmerzenimMund-/Augenbereichvor.WennIhreKörpertemperaturerhöht

istundSiesichaufgrundeinerdieserNebenwirkungenunwohlfühlen,setzenSiesich

unverzüglichmitIhremArztinVerbindung.

Monotherapie(d.h.eineBehandlungausschließlichmitTopiramatPremierResearch25mg)

DiebeieinerMonotherapiebeobachtetenNebenwirkungengleicheninderRegelden

Nebenwirkungen,diewiewährendeinerZusatztherapiebeobachtetwurden.Klinisch

relevanteNebenwirkungen,diebeimitTopiramatbehandeltenErwachsenenmiteiner

Häufigkeitvonmindestens10%auftraten,umfassten:Parästhesien(abnorme

EmpfindungenaufderHaut),Kopfschmerzen,Müdigkeit,Schwindel,Schläfrigkeit,

Gewichtsabnahme,ÜbelkeitundAppetitlosigkeit.

Kinderab2Jahre

NebendenobengenanntenNebenwirkungenwurdeninklinischenStudienmitKindernab2

JahrendiefolgendenNebenwirkungenbeobachtet:ungewöhnlichgesteigerte

Muskelbewegungen(Hyperkinesie),Verhaltensstörungen,vermehrteSpeichelbildung.

Migräne

DosisabhängigeNebenwirkungensindinderRegelselteneralsbeiEpilepsie,dabeider

MigräneniedrigereDoseneingenommenwerden.

InformierenSiebitteIhrenArztoderApotheker,wenneinederaufgeführten

TopiramatPremierResearch25mgFilmtabletten ENR2165072

NebenwirkungenSieerheblichbeeinträchtigtoderSieNebenwirkungenbemerken,die

nichtindieserGebrauchsinformationangegebensind.

5.WIEISTTOPIRAMATPREMIERRESEARCH25MGAUFZUBEWAHREN?

ArzneimittelfürKinderunzugänglichaufbewahren.

SiedürfendasArzneimittelnachdemaufdemBlisterundderFaltschachtelangegebenen

Verfallsdatumnichtmehrverwenden.DasVerfalldatumbeziehtsichaufdenletztenTagdes

Monats.

InderOriginalverpackungaufbewahren,umdenInhaltvorLichtundFeuchtigkeitzu

schützen.

DasArzneimitteldarfnichtimAbwasseroderHaushaltsabfallentsorgtwerden.FragenSie

IhrenApothekerwiedasArzneimittelzuentsorgenist,wennSieesnichtmehrbenötigen.

DieseMaßnahmehilftdieUmweltzuschützen.

6.WEITEREINFORMATIONEN

WasTopiramatPremierResearch25mgenthält:

DerWirkstoffist:Topiramat.1Filmtabletteenthält25mgTopiramat.

DiesonstigenBestandteilesind:MikrokristallineCellulose;PovidonK29-32;Hochdisperses

Siliciumdioxid;Carboxymethylstärke-NatriumTypA(Ph.Eur.);Magnesiumstearat

(Ph.Eur.);Titandioxid(E171);Hypomellose;Macrogol400;Polysorbat80.

WieTopiramatPremierResearch25mgaussiehtundInhaltderPackung:

Weiße,rundeFilmtablettenmitderPrägung„G“aufdereinenSeiteund„TO“über„25“auf

deranderenSeite.

TopiramatPremierResearch25mgistinBlisterpackungenmit10,20,28,50,100und200

Filmtablettenerhältlich.

UnverkäuflichesMuster:TablettenbehältnisoderBlisterpackungmit10Filmtabletten

PharmazeutischerUnternehmer

MylanduraGmbH

Wittichstraße6

64295Darmstadt Hersteller

McDermottLaboratoriesLtd.

(t/aGerardLaboratories)

35/36BaldoyleIndustrialEstate

GrangeRoad

Dublin13

Irland

DieseGebrauchsinformationwurdezuletztüberarbeitetim

Mai2010

ENR:2165072-2165075

Fachinformation

1. BezeichnungderArzneimittel

TopiramatPremierResearch25mgFilmtabletten

TopiramatPremierResearch50mgFilmtabletten

TopiramatPremierResearch100mgFilmtabletten

TopiramatPremierResearch200mgFilmtabletten

2. QualitativeundquantitativeZusammensetzung

Wirkstoff:Topiramat

TopiramatPremierResearch25mgFilmtabletten:

1Filmtabletteenthält25mgTopiramat.

TopiramatPremierResearch50mgFilmtabletten:

1Filmtabletteenthält50mgTopiramat.

TopiramatPremierResearch100mgFilmtabletten:

1Filmtabletteenthält100mgTopiramat.

TopiramatPremierResearch200mgFilmtabletten:

1Filmtabletteenthält200mgTopiramat.

DievollständigeAuflistungdersonstigenBestandteilesieheAbschnitt6.1.

3. Darreichungsform

Filmtablette

TopiramatPremierResearch25mgFilmtabletten:

Weiße,runde,bikonvexeFilmtablettenmitderPrägung„G“aufdereinenSeiteund„TO“

über„25“aufderanderenSeite.

TopiramatPremierResearch50mgFilmtabletten:

Gelbe,runde,bikonvexeFilmtablettenmitderPrägung„G“aufdereinenSeiteund„TO“

über„50“aufderanderenSeite.

TopiramatPremierResearch100mgFilmtabletten:

Gelbe,runde,bikonvexeFilmtablettenmitderPrägung„G“aufdereinenSeiteund„TO“

über„100“aufderanderenSeite.

TopiramatPremierResearch200mgFilmtabletten:

Rote,runde,bikonvexeFilmtablettenmitderPrägung„G“aufdereinenSeiteund„TO“

über„200“aufderanderenSeite.

4. KlinischeAngaben

4.1 Anwendungsgebiete

TopiramatPremierResearch25mg/-50mg/-100mg/-200mgFilmtabletten:

de_7705 Mai 2010 Seite:1von17

ENR:2165072-2165075

ZurMonotherapiebeiErwachsenenundKindernab2Jahrenmitneudiagnostizierter

EpilepsieoderzurUmstellungaufeineMonotherapie.

ZurZusatztherapiebeiErwachsenenundKindernab2Jahrenmit

fokalenepileptischenAnfällenmitoderohnesekundärerGeneralisierung,

primärgeneralisiertentonisch-klonischenAnfällenund

epileptischenAnfällenbeimLennox-Gastaut-Syndrom.

TopiramatPremierResearch25mg/-50mg/-100mgFilmtablettenzusätzlich:

ZurMigräneprophylaxebeiErwachsenenalsMittelderzweitenWahl.

4.2 Dosierung,ArtundDauerderAnwendung

ZureinschleichendenDosierungstehenTopiramatPremierResearch25mgFilmtabletten

zurVerfügung.DieEindosierungsolltedurchdasklinischeBildbestimmtwerden.

EPILEPSIE:

DosierunginderMonotherapie

WerdenbislangverabreichteAntiepileptikaabgesetzt,umaufdieMonotherapiemit

Topiramatumzustellen,wirddaslangsameAusschleichenderbisherigenMedikation

empfohlen.WerdenenzyminduzierendeAntiepileptikaabgesetzt,steigtderTopiramat-

Plasmaspiegelan.Daherkann,fallsklinischindiziert,eineniedrigereTopiramat-Dosierung

erforderlichsein.

Erwachsene:

DieEindosierungsollteindererstenWochemit25mgTopiramat/Tagabendsbeginnen.

Anschließendsolltealle1-2WochendieDosisum25-50mgTopiramat/Tag,verteiltauf

zweiEinzelgaben,gesteigertwerden.

DieempfohleneinitialeZieldosisfürErwachseneliegtinderMonotherapiebei100mg

TopiramatproTag.DiemaximalempfohleneTagesdosisbeträgt500mgTopiramat.

Kinder2Jahre:

DieEindosierungsollteindererstenWochemit0,5-1mg/kgKG/Tagabendsbeginnen.

AnschließendsolltedieDosisalle1-2Wochenum0,5-1mg/kgKG/Tag,verteiltaufzwei

Einzelgaben,gesteigertwerden.

DieempfohleneinitialeZieldosisfürKinderab2JahrenbeträgtinderMonotherapie

3-6mg/kgKG/Tag.

DosierunginderZusatztherapie:

Erwachsene:

DieEindosierungsollteindererstenWochemit25-50mgTopiramat/Tagabends

beginnen.Anschließendsolltealle1-2WochendieDosisum25-50mgTopiramat/Tag,

verteiltaufzweiEinzelgaben,gesteigertwerden.BeieinigenPatientenistauchdie

Einmalgabemöglich.

DieüblichetäglicheErhaltungsdosisfürErwachseneliegtinderZusatztherapiezwischen

200mgund400mgTopiramat/Tag,verteiltaufzweiEinzelgaben.

Kinder2Jahre:

de_7705 Mai 2010 Seite:2von17

ENR:2165072-2165075

DieempfohleneDosisbeträgtfürKinderab2JahreninderZusatztherapie5-9mg

Topiramat/kgKG/Tag,verteiltaufzweiEinzelgaben.IndererstenWochesolltedie

Eindosierungmit25mgTopiramat/Tagabendsbeginnen(oderweniger,basierendauf

einemDosierungsbereichzwischen0,5und1mg/kgKG/Tag).Anschließendsolltedie

Dosisalle1-2Wochenumca.1mg/kgKG/Tag,verteiltaufzweiEinzelgaben,gesteigert

werden.

Tagesdosenbiszu30mg/kgKG/TagwurdenuntersuchtundimAllgemeinengutvertragen.

WeitereAngabenzurDosierungimRahmenderEpilepsiebehandlung:

Dosisanpassung:

BeiBedarfkönnengeringereDosissteigerungenoderlängereIntervallezwischenden

Dosissteigerungengewähltwerden.

EineBestimmungderTopiramat-PlasmaspiegelzurOptimierungderBehandlungistnicht

notwendig,dakeinedirekteBeziehungzwischenderBlutplasmakonzentrationvon

TopiramatundseinerWirksamkeitbesteht.

Behandlungsende:

SowohlbeiPatientenmitalsauchohneanamnestischbekannteKrampfanfälleund

EpilepsiesolltenAntiepileptikaeinschließlichTopiramatschrittweisereduziertwerden,um

dasRisikovonKrampfanfällenodereinesAnstiegsderAnfallsfrequenzzuverringern.In

klinischenStudienwurdedieTagesdosisbeiErwachsenenmitEpilepsieinwöchentlichen

Intervallenum50-100mgreduziert.InklinischenStudienmitKindernwurdeTopiramat

schrittweiseübereineDauervon2-8Wochenausgeschlichen.InSituationen,woein

schnellesAbsetzenvonTopiramatmedizinischindiziertist,wirdeinegeeignete

Überwachungempfohlen

TopiramatPremierResearch25mg/-50mg/-100mgFilmtabletten:

MIGRÄNE-PROPHYLAXE

Erwachsene:

DieEindosierungsolltewährenddererstenWochemit25mgTopiramatamAbend

beginnen.AnschließendsollteinwöchentlichenAbständendieTagesdosisum25mg

gesteigertwerden(1.Woche:25mg/Tag,2.Woche50mg/Tagusw.).FallsderPatient

dasEindosierungsschemanichtverträgt,könnenlängereIntervallezwischenden

Dosisanpassungengewähltwerden.

DieempfohleneGesamttagesdosisvonTopiramatbeiderAnwendunginder

Migräneprophylaxebeträgt100mg/Tag,verteiltaufzweiEinzelgaben.HöhereDosen

führtennichtzueinemgrößerenNutzen.EinigePatientenkönnenbeieiner

Gesamttagesdosisvon50mg/TagbereitseinenNutzenerfahren.DieDosierungunddie

EindosierungsolltendurchdasklinischeBildbestimmtwerden.

de_7705 Mai 2010 Seite:3von17

ENR:2165072-2165075

Behandlungsende:

Istgeplant,dieBehandlungzubeenden,solltedieTopiramatdosisschrittweisereduziert

werden.

AnwendungsgebieteEpilepsieundMigräne-Prophylaxe:

PatientenunterHämodialyse:

DaTopiramatdurchHämodialyseausdemBlutplasmaentferntwird,istesnotwendig,bei

Hämodialyse-PatientenamTagderDialysedieDosisumca.dieHälftezuerhöhen.Diese

ErhöhungsollteaufzweiDosenverteiltwerden:unmittelbarvorundbeiBeendigungder

Dialyse.DiezusätzlichbenötigteDosiskannvonderangewendetenDialysemethodebzw.

demDialysegerätabhängigsein.

ArtderAnwendung:

DieEinnahmevonderTopiramatPremierResearchFilmtablettenkannunabhängigvon

denMahlzeitenerfolgen.

TopiramatPremierResearchFilmtablettensindganz,unzerkautundmitausreichend

Flüssigkeiteinzunehmen.

4.3 Gegenanzeigen

ÜberempfindlichkeitgegenüberTopiramatodereinendersonstigenBestandteiledes

Arzneimittels.

WennTopiramatalsProphylaxevonMigräne-Kopfschmerzeneingenommenwird:

InderSchwangerschaftundFrauenimgebärfähigenAlter,fallskeinewirksame

Verhütungsmethodeangewendetwird(sieheAbschnitt.4.6).

TopiramatPremierResearch200mgFilmtablettenzusätzlich:

ÜberempfindlichkeitgegenüberGelborangeS,Aluminiumsalz.

4.4 BesondereWarnhinweiseundVorsichtsmaßnahmenfürdieAnwendung

KinderundJugendliche:

Epilepsie:

BeiKindernunter2JahrensollteTopiramatnichtangewendetwerden,dafürdiese

AltersgruppenochkeineausreichendenklinischenErfahrungenvorliegen.

Migräne-Prophylaxe:

TopiramatPremierResearchsolltebeiKindernundJugendlichennichtangewendet

werden,dafürdieseAltersgruppeinderMigräneprophylaxenochkeineausreichenden

klinischenErfahrungenvorliegen.

MigräneprophylaxebeiErwachsenen:

BeiPatientenunterLangzeitbehandlungmitTopiramatzurMigräneprophylaxesollte

regelmäßigdasGewichtbestimmtwerdenundeineÜberwachungbezüglichanhaltendem

Gewichtsverlusterfolgen.WenneinklinischbedeutsamerGewichtsverlusteintritt,sollte

dasAbsetzenderMedikationinBetrachtgezogenwerden.

de_7705 Mai 2010 Seite:4von17

ENR:2165072-2165075

Patienten mit eingeschränkter Nierenfunktion:

TopiramatundseineMetabolitewerdenhauptsächlichüberdieNierenausgeschieden.

DahersollbeieingeschränkterNierenfunktionmiteinerKreatinin-Clearancevonweniger

als60ml/minmitVorsichtdosiertwerden.BeiälterenPatientenistandieMöglichkeiteiner

eingeschränktenNierenfunktionzudenken.Eswirdempfohlen,beidiesenPatientenmit

einerniedrigenTopiramatdosiszubeginnenundbesondersaufdasAuftretenvon

Nebenwirkungenzuachten.BeiPatientenmitmäßigerbisschwerer

NierenfunktionsstörungkannesbiszurEinstellungeinesgleichmäßigenPlasmaspiegels

10bis15Tagedauern,verglichenmit4bis8TagenbeiPatientenmitnormaler

Nierenfunktion.

Nephrolithiasis:

InsbesonderebeiprädisponiertenPatientenkanneinerhöhtesRisikofürNephrolithiasis

unddamiteinhergehendenAnzeichenundSymptomenwieNierenkolik,Nierenschmerzen

oderFlankenschmerzenvorliegen.RisikofaktorenfüreineNierensteinbildungsind,neben

familiärerVeranlagung,bereitsfrüheraufgetreteneNierensteineundHyperkalziurie.Bei

VorliegendieserRisikofaktorenkommtesjedochnichtzwangsläufigzueiner

NierensteinbildungunterTopiramat-Behandlung.EinerhöhtesRisikobestehtaußerdembei

Patienten,diebereitsandereArzneimittel,diedieNierensteinbildungfördernkönnen(siehe

4.5"WechselwirkungenmitanderenMitteln"),einnehmen.

Verminderte Leberfunktion:

BeiPatientenmiteingeschränkterLeberfunktionsolltedieBehandlungmitTopiramatmit

Vorsichterfolgen,dadieTopiramat-Clearancevermindertseinkann.

Akute Myopie und sekundäres Engwinkelglaukom:

UnterTopiramatwurdeinEinzelfällenüberakuteMyopieundsekundäres

Engwinkelglaukomberichtet,dasvoneinemsupraziliärenÖdemmitVorverlagerungvon

LinseundIrisbegleitetseinkann.DabeisindeineakuteVerminderungderSehschärfe

und/oderAugenschmerzenaufgetreten.OphthalmologischkonnteneineEinengungder

vorderenAugenkammer,okuläreHyperämie(Rötung)undangestiegenerintraokulärer

DruckmitoderohneMydriasisfestgestelltwerden.DieSymptometratensowohlbei

KindernalsauchbeiErwachsenenüblicherweiseinnerhalbdesersten

BehandlungsmonatsmitTopiramatauf.DieBehandlungmitTopiramatsollteumgehend

beendetundgeeigneteMaßnahmenzurraschenVerminderungdesintraokulärenDrucks

ergriffenwerden.

Metabolische Azidose:

AufgrundeinerhemmendenWirkungaufdierenaleCarboanhydrasekannsichunterder

BehandlungmitTopiramateinehyperchlorämischemetabolischeAzidosemitnormaler

Anionenlücke(d.h.AbsinkendesSerum-BicarbonatspiegelsaufWerteunterhalbdes

NormbereichsohneVorliegeneinerrespiratorischenAlkalose)entwickeln.Soweiteszu

einemAbfalldesBicarbonatspiegelskommt,trittdieserinderRegelzuBeginneiner

Topiramat-Therapieauf;einAbfallistjedochzujedemBehandlungszeitpunktmöglich.Die

AbnahmedesBicarbonatspiegelsistinderRegelgeringbismäßigmiteinem

durchschnittlichenRückgangderWerteum4mmol/lbeiTagesdosenvon100mgoder

darüberbeiErwachsenenbzw.ca.6mg/kg/TagbeiKindern;Werteunter10mmol/lwurden

seltenbeobachtet.KlinischeBedingungenoderTherapien,diedieAusbildungeiner

Azidosebegünstigen(z.B.Nierenerkrankungen,schwereErkrankungendes

respiratorischenSystems,Statusepilepticus,Diarrhö,chirurgischeEingriffe,ketogeneDiät

oderbestimmteMedikamente)könnendiebicarbonatsenkendeWirkungvonTopiramat

verstärken.

ChronischemetabolischeAzidosebeipädiatrischenPatientenkanndasWachstum

verringern.

DieAuswirkungenvonTopiramataufWachstumundKnochensindbeiKindernund

Erwachsenennichtsystematischuntersuchtworden.

de_7705 Mai 2010 Seite:5von17

ENR:2165072-2165075

ChronischemetabolischeAzidoseerhöhtdasRisikoderNierensteinbildungundkann

potentiellzuOsteopenieführen.PatientensolltenwährendderTherapiemitTopiramat

hinsichtlicheinermetabolischenAzidoseuntersuchtwerden.DieseUntersuchungkanndie

BestimmungvonBicarbonatoderChloridimSerumoderBlutgasanalysen,abhängigvon

derklinischenSituation,beinhalten.WennsicheinemetabolischeAzidoseentwickeltund

fortbesteht,sollteeineVerringerungderDosisoderdieBeendigungderBehandlungmit

TopiramatinBetrachtgezogenwerden(Dosisausschleichen).

Stimmungsschwankungen/Depression:

DepressionenundStimmungsschwankungensindbeiPatienten,diemitAntiepileptikain

verschiedenenIndikationenbehandeltwurden,berichtetworden.EineMetaanalyse

randomisierter,placebo-kontrollierterStudienmitAntiepileptikazeigteeinleichterhöhtes

RisikofürsuizidaleGedankenundsuizidalesVerhalten.DerMechanismusfürdieses

RisikoistnichtbekanntunddieverfügbarenDatenschließendieMöglichkeiteines

erhöhtenRisikosfürTopiramatnichtaus.DeshalbsolltenPatientenhinsichtlichAnzeichen

vonDepressionen,SuizidgedankenundsuizidalemVerhaltenüberwachtwerdenundeine

adäquateBehandlungsollteinErwägunggezogenwerden.Patienten(undderenBetreuer)

solltendaraufhingewiesenwerden,dasssiemedizinischenRateinholen,wennsichdie

AnzeichenfüreineDepressionund/odersuizidaleGedankenverstärken.

Suizidversuch:

InderDoppelblind-PhaseklinischerStudienzuzugelassenen-undinklinischerErprobung

befindlichenIndikationentratenSuizidversuchemiteinerHäufigkeitvon0,003(13

Fälle/3999Patientenjahre)unterTopiramatgegenüber0(0Fälle/1430Patientenjahre)

unterPlazeboauf.

Kalorische Ergänzung:

WährendderTherapiesolltenbeiPatientenmitGewichtsverlustdiätetischeMaßnahmen

odergesteigerteNahrungsaufnahmeerwogenwerden.

Ausreichende Flüssigkeitszufuhr:

EineausreichendeFlüssigkeitszufuhrunterderBehandlungmitTopiramatistsehrwichtig.

DiesekanndasRisikoeinerNephrolithiasisvermindern.AusreichendeFlüssigkeitszufuhr

vorundwährendAktivitätenwieSportoderbeiWärmeexpositionkanndasRisiko

hitzebedingterNebenwirkungenreduzieren(sieheAbschnitt4.8"Nebenwirkungen").

4.5 WechselwirkungenmitanderenArzneimittelnundsonstigeWechselwirkungen

Einfluss von Topiramat auf andere Antiepileptika:

PlasmakonzentrationenvonanderenAntiepileptikawieCarbamazepin,Phenobarbital,

Primidon,ValproinsäureundLamotriginwerdendurchTopiramatnichtbeeinflusst.Bei

gleichzeitigerTherapiemitPhenytoinwurdegelegentlicheinAnstiegder

Phenytoinkonzentrationbeobachtet.DiesistvermutlichaufeineEnzymhemmung

(CYP2C

meph. )zurückzuführen.BeijedemmitPhenytoinbehandeltenPatienten,der

AnzeicheneinerÜberdosierungzeigt,solltendiePhenytoin-Spiegelkontrolliertwerden.

Einfluss anderer Antiepileptika auf Topiramat:

DiePlasmakonzentrationvonTopiramatwirddurchPhenytoinundCarbamazepin

vermindert.WerdendieseArzneimittelneuindieTherapieintegriertoderabgesetzt,kann

eineAnpassungderTopiramat-Dosiserforderlichsein.EsergibtsichkeineBeeinflussung

durchValproinsäureundLamotrigin.

Digoxin:

IneinerklinischenStudiewurdenachEinmalgabevonTopiramateinAbsinkender

Serumdigoxinspiegel(AUC)um12%festgestellt.DieklinischeBedeutungdieses

Befundesistnochnichtzubeurteilen.BeiPatienten,dieDigoxinerhalten,solltendie

Plasmaspiegelkontrolliertwerden,wennTopiramatneuindieTherapieaufgenommenoder

abgesetztwird.

de_7705 Mai 2010 Seite:6von17

ENR:2165072-2165075

Orale Kontrazeptiva:

IneinerpharmakokinetischenInteraktionsstudieangesundenProbandenwurdeTopiramat

ineinemDosierungsbereichvon50-200mgproTaggleichzeitigmiteinemkombinierten

oralenKontrazeptivummit1mgNorethisteronund35µgEthinylestradiolohneweitere

Begleitmedikationeingenommen.EswurdenkeinestatistischsignifikantenÄnderungender

durchschnittlichenAUC(AreaUndertheCurve)derwirksamenBestandteiledesoralen

kombiniertenKontrazeptivumsbeobachtet.IneinerweiterenStudiewardieAUCvon

EthinylestradiolbeiDosierungenvon200mg,400mgund800mgTopiramatproTagund

gleichzeitigerEinnahmevonValproinsäurestatistischsignifikantvermindert(18%,21%

und30%).

ObwohlineinemDosierungsbereichvon200-800mgTopiramatproTageine

dosisabhängigeVerminderungderAUCvonEthinylestradiolbeobachtetwurde,lagin

einemDosierungsbereichvon50bis200mgTopiramatproTagkeinedosisabhängige

signifikanteVeränderungderAUCvonEthinylestradiolvor.BezüglichNorethisteronhatte

TopiramatinbeidenStudien(50mg-800mgproTag)keinensignifikantenEinflussaufdie

AUC.

DieklinischeBedeutungdieserBeobachtungenistnichtbekannt.DieMöglichkeiteiner

vermindertenkontrazeptivenWirksamkeitunddasvermehrteAuftretenvon

DurchbruchblutungensolltebeiPatientinnen,dieeinoraleskombiniertesKontrazeptivum

zusammenmitTopiramateinnehmen,beachtetwerden.DiekontrazeptiveWirksamkeit

kannauchvermindertsein,wennkeineDurchbruchblutungenauftreten.

Patientinnen,dieoraleestrogenhaltigeKontrazeptivaeinnehmen,solltenangewiesen

werden,ihrembehandelndenArztjedeVeränderungdesMenstruationszyklusmitzuteilen.

Hydrochlorothiazid (HCTZ):

HCTZerhöhteineinerKinetikstudiediePlasmaspiegelvonTopiramatumca.30%,so

dasseineDosiserniedrigungratsamseinkann.WeiterhinergabensichHinweise,dass

HCTZdieKaliumspiegelinKombinationmitTopiramatstärkersenkt.

Risperidon:

InteraktionsstudienunterEinmal-undMehrfachgabebeigesundenProbandenund

PatientenmitbipolarenStörungenführtenzuähnlichenErgebnissen.Beigleichzeitiger

GabemitTopiramatinansteigendenDosierungenvon100mg,250mgund400mglTag

wardiesystemischeVerfügbarkeitvonRisperidon(verabreichtinDosierungenzwischen

16mglTag)vermindert(16%und33%fürjeweilsdie250mg-und400mglTag-

Dosierung).PharmakokinetischwirddieVerfügbarkeitvonRisperidonsowieseinesaktiven

Metaboliten9-Hydroxy-RisperidoninentgegengesetzterWeisebeeinflusst.Daheristdavon

auszugehen,dasssichbeigleichzeitigerGabevonRisperidonundTopiramathinsichtlich

desNettoeffekteskeineklinischsignifikantenÄnderungendersystemischenVerfügbarkeit

dergesamtenaktivenFraktionvonRisperidonodervonTopiramatergeben.Diese

InteraktionistsomitwahrscheinlichnichtvonklinischerBedeutung.

Metformin:

DieErgebnisseeinerStudie,beiderMetforminalleinundMetformingleichzeitigmit

TopiramatgesundenProbandengegebenwurde,zeigen,dassdiedurchschnittliche

maximalePlasmakonzentration(C

)um18%unddiedurchschnittlicheAUC

0-12h von

Metforminum25%ansteigen.DiemittlereCL/FfälltbeigleichzeitigerGabevonMetformin

undTopiramatum20%.TopiramathatkeinenEinflussauft

vonMetformin.Dieorale

PlasmaclearancevonTopiramatkannbeigleichzeitigerGabevonMetforminreduziertsein.

DasAusmaßderÄnderungderClearanceistnichtbekannt.

DieklinischeBedeutungdesEinflussesvonMetforminaufdiePharmakokinetikvon

Topiramatundumgekehrtistnichtausreichendgeklärt.WirdTopiramatbeiPatientenunter

Metformin-Therapieneueingesetztoderabgesetzt,sollteeinesorgfältigeKontrollederbei

DiabetesmellitusüblichenParameterdurchgeführtwerden.

Glibenclamid:

de_7705 Mai 2010 Seite:7von17

ENR:2165072-2165075

InteraktionsstudienbeiPatientenmitTypli-DiabetesmitGlibenclamid(5mglTag)alleinund

gleichzeitigerGabevonTopiramat(150mglTag)zeigteneineReduktionderAUC24von

Glibenclamidum25%beigleichzeitigerGabevonTopiramat.Diesystemische

VerfügbarkeitderaktivenMetabolite,4-trans-Hydroxyglibenclamid(M1)und3-

cicHydroxyglibenclamid(M2)warebenfallsumjeweils13%und15%vermindert.Die

SteadyStatePharmakokinetikvonTopiramatwarbeigleichzeitigerGabevonGlibenclamid

unbeeinflusst.WennTopiramatzueinerGlibenclamid-TherapieoderGlibenclamidzueiner

Topiramat-Therapiehinzugefügtwird,solltensorgfältigeRoutineuntersuchungen

durchgeführtwerden,umeineadäquateKontrollederDiabetes-Erkrankungzu

gewährleisten

Pioglitazon:

IneinerKinetikstudiesenkteTopiramatdiePlasmaspiegelvonPioglitazonundseines

aktivenMetaboliten,wobeidieklinischeBedeutungoffenbleibt.BeiKombinationder

beidenMedikamentesolltendieRoutinekontrollenbeiDiabetesmellitusbesonders

sorgfältigüberwachtwerden.

Lithium:

BeigesundenProbandenwurdebeigleichzeitigerVerabreichungvon200mg

TopiramatlTageineReduktiondersystemischenLithiumverfügbarkeit(18%derAUC)

beobachtet.BeiPatientenmitbipolarenStörungenzeigtesichbeieinerDosierungvon200

mgTopiramatlTagkeineBeeinflussungderPharmakokinetikvonLithium;jedochwurdebei

Dosierungenbiszu600mgTopiramatlTageinAnstiegdersystemischenVerfügbarkeit(26

%derAUC)beobachtet.Lithium-SpiegelsolltenbeigleichzeitigerGabevonTopiramat

überwachtwerden

Valproinsäure:

DiegleichzeitigeGabevonTopiramatundValproinsäurewurdemiteinerHyperammonämie

mitundohneEnzephalopathiebeiPatienteninVerbindunggebracht,dieeinesderbeiden

Medikamentealleinevertragenhaben.IndenmeistenFällennahmendieSymptomeund

AnzeichenbeiAbsetzenvoneinemderbeidenMedikamenteab.Diesesunerwünschte

EreignisistnichtaufeinepharmakokinetischeInteraktionzurückzuführen.Ein

ZusammenhangeinerHyperammonämiemiteinerTopiramat-Monotherapieoderbei

gleichzeitigerBehandlungmitanderenAntiepileptikakonntenichtnachgewiesenwerden

AndereArzneimittel:

InKombinationmitanderenMitteln,diezueinerNephrolithiasisprädisponieren,kann

TopiramatzueinemerhöhtenNierensteinRisikoführen.DiegleichzeitigeEinnahme

solcherMittel,insbesonderevonAcetazolamid,Triamteren,ZonisamidundVitaminCin

Mengenüber2g/Tag,solltedahervermiedenwerden.

DiegleichzeitigeEinnahmevonCarboanhydrase-Inhibitoren(z.B.Sultiam,Zonisamid)und

TopiramatwurdeinklinischenStudiennichtuntersucht.IhreKombinationkann

möglicherweisedieNebenwirkungenderCarboanhydrasehemmungbeieinigenPatienten

verstärken.

Laborwerte:

DatenklinischerStudiendeutendaraufhin,dassdieEinnahmevonTopiramatmiteiner

durchschnittlichenVerminderungdesSerum-Bicarbonatspiegelsum4mmol/lverbundenist

(sieheAbschnitt4.4"WarnhinweiseundVorsichtsmaßnahmenfürdieAnwendung").

AufgrunddespharmakokinetischenProfilsvonTopiramatdürftedenpharmakokinetischen

InteraktionenmitanderenArzneimittelnkeinegrößereBedeutungzukommen.Dennoch

sindpharmakodynamischeInteraktionen,z.B.mitzentraldämpfendenWirkstoffenund

Alkohol,nichtauszuschließen.

AusKinetikstudienergabensichHinweise,dassTopiramatFlunarizinundDiltiazemsowie

dieMetabolitenvonAmitryptilin,Haloperidol,DiltiazemundPropranololbeeinflusst.

PropranololundDiltiazemerhöhendenPlasmaspiegelvonTopiramat

de_7705 Mai 2010 Seite:8von17

ENR:2165072-2165075

4.6 SchwangerschaftundStillzeit

Schwangerschaft

WiebeianderenMedikamentendieserWirkstoffklassemussbeiderEinnahmevon

TopiramatwährendderSchwangerschaftmiteinemerhöhtenFehlbildungsrisikofürdas

ungeboreneKindgerechnetwerden.

InderSchwangerschaftstelltdasAuftretenvonepileptischenAnfälleneineerhebliche

GefahrfürMutterundKinddar.DieVerhinderungvonepileptischenAnfällendurch

TopiramatüberwiegtunterderVoraussetzung,dassesmitderrichtigenIndikation

verabreichtwird,dasRisikovonMissbildungen.DieVerhinderungvonMigräneattacken

überwiegtdiesesRisikodagegennicht.DaheristTopiramatfürdieAnwendunginder

MigräneprophylaxeinderSchwangerschaftundbeiFrauenimgebärfähigenAlter,wennsie

keinewirksameVerhütungsmethodeanwenden,kontraindiziert.

IndikationProphylaxevonMigräne-Kopfschmerzen

TopiramatinderSchwangerschaftkontraindiziert(siehe4.3).FrauenimgebärfähigenAlter

solltenwährendeinerTherapiemitTopiramateineadäquateMethodezur

Empfängnisverhütunganwenden(sieheauch4.5,Wechselwirkungen,oraleKontrazeptiva).

IndikationEpilepsietherapie

Esistbekannt,dassbeiKindernvonMüttern,diewährendderSchwangerschaftein

Antiepileptikumeingenommenhaben,dasRisikofürangeboreneFehlbildungenim

VergleichzuKindern,dievonnichtanEpilepsieerkranktenFrauengeborenwurden,um

denFaktor2-3erhöhtist.TopiramaterwiessichanverschiedenenTierartenalsteratogen

undembryotoxisch(siehe5.3).TopiramatistbeimMenschenplazentagängig.

InderSchwangerschaftdarfTopiramatdahernurangewendetwerden,wennkeine

TherapiealternativenzurVerfügungstehenunddermöglicheNutzenfürdieMutterdas

möglicheRisikofürdasungeboreneKindüberwiegt.

DadiegleichzeitigeAnwendungmehrererAntiepileptika(Polytherapie)währendder

SchwangerschaftzueinerweiterenErhöhungdesRisikosfürangeboreneFehlbildungen

führenkann,sollteTopiramatbeiFrauenimgebärfähigenAlterundbesonderswährendder

SchwangerschaftmöglichstalsMonotherapieundinderniedrigstenwirksamenDosis

angewendetwerden.InkeinemFallsollteeineBehandlungmitTopiramatohneärztlichen

Ratabgebrochenwerden,daunkontrollierteAnfällesowohlfürdieMutteralsauchfürdas

ungeboreneKindschwerwiegendeKonsequenzenhabenkönnen.

FrauenimgebärfähigenAltersolltendaherunbedingtaufdieNotwendigkeitvonPlanung

undÜberwachungeinereventuellenSchwangerschafthingewiesenwerden.Wennunter

einerBehandlungmitTopiramateineSchwangerschafteintrittoderwenndieBehandlung

mitTopiramatinderSchwangerschafterforderlichist,mussdieNotwendigkeiteiner

AnfallskontrollesorgfältiggegendasmöglicheRisikodieserTherapiefürdasungeborene

Kindabgewogenwerden.

NachEinnahmevonTopiramatinderSchwangerschaft,zumTeilinKombinationmit

anderenArzneimitteln,istbeiNeugeborenensehrselteneineHypospadieaufgefallen;ein

kausalerZusammenhangistbishernichtgesichert.

de_7705 Mai 2010 Seite:9von17

ENR:2165072-2165075

Stillzeit

DaTopiramatindieMuttermilchübergehtundNebenwirkungenfürdenSäuglingnicht

ausgeschlossenwerdenkönnen,sollTopiramatinderStillzeitnichteingenommenwerden.

FallseineBehandlungmitTopiramatinderStillzeitzwingenderforderlichist,muss

abgestilltwerden.

4.7 AuswirkungenaufdieVerkehrstüchtigkeitunddieFähigkeitzumBedienenvon

Maschinen

TopiramatwirktaufdasZentralnervensystem(ZNS)undkannauchbei

bestimmungsgemäßemGebrauchundbesondersinderAnfangsphasederTherapie

Schwindel,SchläfrigkeitundähnlicheSymptomeverursachen.DieFähigkeitzurTeilnahme

amStraßenverkehroderzumBedienenvonMaschinenkanndadurchbeeinträchtigt

werden.DiesgiltinverstärktemMaßeimZusammenwirkenmitAlkohol.

4.8 Nebenwirkungen

DasNebenwirkungsprofilvonTopiramatbasiertaufDatenvon1.800Probandenaus

klinischenStudien.BeidenHäufigkeitsangabenzuNebenwirkungenwerdenfolgende

Kategorienzugrundegelegt:

Sehrhäufig(1/10)

Häufig (1/100bis<1/10)

Gelegentlich (1/1.000bis<1/100)

Selten (1/10.000bis<1/1.000)

Sehrselten (<1/10.000)

Nichtbekannt (HäufigkeitaufGrundlagederverfügbarenDatennichtabschätzbar)

Systemorgan-klasse Sehrhäufig Häufig GelegentlichSelten

AllgemeineErkrankungenund

BeschwerdenamVerabrei-

chungsort Schwindel,

Müdigkeit,

Schläfrigkeit,

Nervosität,

Kopfschmerzen,

Übelkeit Skelettschmer-

zen,allergische

Reaktionen,

Schlaflosigkeit

Stoffwechsel-undErnährungs-

störungen Gewichtsverlust Metabolische

Azidose

ErkrankungendesBlutesund

desLymphsystems Anämie,

Nasenbluten,

Purpura,

Leukopenie,

Thrombozyto-

penie Neutropenie

PsychiatrischeErkrankungen Gedächtnis-

störungen,

Appetitlosigkeit,

Verwirrtheitund

psychomotorisch

e

Verlangsamung,

Depression,

Konzentrations-

Apathie,

Asthenie,

Euphorie,emo-

tionaleLabilität,

Agitation,kogni-

tiveProbleme,

Libidominderung,

aggressive

Reaktionen,

Psychoseoder

Halluzina-

tionen,

Persönlich-

keitsstö-

rungen,

Suizidge-

danken,

Suizidver-

suche

de_7705 Mai 2010 Seite:10von17

ENR:2165072-2165075

Symptome

ErkrankungenderAtemwege,

desBrust-raumsund

Mediastinums Dyspnoe

Erkrankungendes

Gastrointesti-naltrakts Obstipation,

Bauchschmerzen Diarrhoe,

Erbrechen

undMund-

trockenheit

ErkrankungenderHautund

desUnterhaut-zellgewebes Alopezie Folliculitis

undPruritus

ErkrankungenderNierenund

Harnwege Harninkontinenz,

Nephrolithiasis

Erkrankungendes

Nervensystems Ataxie,

Parästhesie,

Sprachstörungen

,Aphasie Tremor,

Koordinations-

störung,

Gangstörung,

Nystagmus,

Geschmacks-

veränderung Hypokinesie,

Stupor

Leber-undGallener-

krankungen Anstiegder

Leber-

enzyme

Augener-krankungen Doppelbilder,

Sehstörungen AkuteMyopie

und

sekundäres

Engwinkel-

glaukom,

Augen-

schmerzen

Erkrankungender

Geschlechts-organeundder

Brustdrüse Menstruations-

störungen,

Impotenz

BeiPatienten,dieTopiramatalsAdd-On-Therapieerhielten,wurdenthromboembolische

Ereignissebeietwa1Fallvonpro100Patientenjahrebeschrieben.InderMehrzahlder

FällehandelteessichumPatienten,dieübermehralseinhalbesJahrbehandeltwurden

undmehralseinenRisikofaktoraufwiesen.EskonntekeinkausalerZusammenhangmit

Topiramatnachgewiesenwerden.

DaTopiramatamhäufigstengemeinsammitanderenAntiepileptikaverabreichtwurde,ist

esschwierigzubestimmen,welcheSubstanzen-wennüberhaupt–mitNebenwirkungen

inZusammenhangstehen.

DieArtenvonunerwünschtenEreignissen,dieimRahmenvonStudienzurMonotherapie

genanntwurden,warenqualitativimAllgemeinenmitdenenvergleichbar,dieinStudienzur

Zusatztherapiebeobachtetwurden.MitAusnahmevonParästhesienundMüdigkeitwurden

dieseunerwünschtenEreignisseinStudienzurMonotherapiemitvergleichbarenoder

niedrigerenInzidenz-Ratenbeobachtet.IndoppelblindenklinischenStudientratendie

folgendenklinischrelevantenunerwünschtenEreignissebeimitTopiramatbehandelten

ErwachsenenmiteinerInzidenzvongrößerodergleich10%auf:Parästhesien,

Kopfschmerzen,Müdigkeit,Schwindel,Somnolenz,Gewichtsabnahme,Übelkeitund

Anorexie.

AusderAnwendungnachMarkteinführungliegenfürPatienten,diemitTopiramat

behandeltwurden,selteneBerichteübereinenAnstiegderLeberenzyme,Fällevon

de_7705 Mai 2010 Seite:11von17

ENR:2165072-2165075

metabolischerAzidoseundisolierteBerichteüberHepatitisundLeberversagensowieauch

BerichteüberKrampfanfällenachAbsetzenvonTopiramatvor(auchbeiPatientenohne

EpilepsieinderVorgeschichte).DatenausklinischenStudienweisendaraufhin,dass

TopiramatmiteinerdurchschnittlichenAbnahmedesBicarbonatSerumspiegelsum4

mmol/Iverbundenist(sieheauchPkt.4.4).UnterderAnwendungvonTopiramatwurde

übereineOligohidrosisberichtet,diemanchmalmitBegleitsymptomenwieFieberund

Flusheinherging.DieMehrzahldieserBerichtestammtvonKindern.Gelegentlichwurde

überSuizid-bezogeneEreignisseberichtet(siehePkt.4.4).

EsliegenisolierteBerichteüberbullöseHaut-undSchleimhaut-Reaktionen(einschließlich

Erythemamultiforme,Pemphigus,Stevens-Johnson-Syndromundtoxischeepidermale

Nekrolyse)vor.DieMehrzahldieserBerichtestammtvonPatienten,dieweitere

Arzneimitteleinnahmen,dieebenfallsmitbullösenHaut-undSchleimhautreaktionen

verbundensind.

EsliegenselteneBerichtezuFällenvonakuterMyopieundsekundärem

EngwinkelglaukombeimitTopiramatbehandeltenPatientenvor(sieheauchPkt.4.4).Die

SymptomeumfasseneineakuteintretendeVerringerungderSehschärfeund/oder

Augenschmerzenundtretentypischerweiseinnerhalbvon1MonatnachBeginnder

Topiramat-Therapieauf.BetroffenwarensowohlpädiatrischePatientenalsauch

Erwachsene.

AusderAnwendungnachMarkteinführungliegensehrselteneBerichteüberFällevon

vorübergehenderBlindheitvor.AllerdingswurdeeinKausalzusammenhangmitder

Behandlungnichtnachgewiesen.

Kinder2>2Jahre

ZusätzlichzudenobengenanntenNebenwirkungenwurdeninklinischenStudienmit

Kindern2>2JahrendiefolgendenNebenwirkungenbeobachtet:Hyperkinesie,

Verhaltensstörungen,übermäßigeSpeichelbildung.

IndoppelblindenklinischenStudienzurMigränewardieInzidenzvondosisabhängigen

NebenwirkungenimAllgemeinenniedrigeralsinStudienzurEpilepsie,daindenMigräne-

StudienniedrigereDosenverwendetwurden.

4.9 Überdosierung

Symptome:

ÜberÜberdosierungenmitTopiramatwurdeberichtet.Symptomewaren:Kopfschmerzen,

Konvulsionen,Schläfrigkeit,Sprachstörungen,verschwommenesSehen,Diplopie,

Denkstörungen,Lethargie,Koordinationsstörung,Stupor,Hypotonie,Abdominalschmerz,

Agitation,Schwindel,Depression.SchwerwiegendeFolgeerscheinungenwurdeninden

meistenFällennichtbeobachtet,abereswurdeüberTodesfällenachgleichzeitiger

ÜberdosierungsehrvielerunterschiedlicherSubstanzen,Topiramateingeschlossen,

berichtet.

EineÜberdosierungmitTopiramatkannzueinerschwerenmetabolischenAzidoseund

Hypokaliämieführen(sieheAbschnitt4.4"WarnhinweiseundVorsichtsmaßnahmenfürdie

Anwendung").

NachEinnahmevonhochgerechnet96-110gTopiramatwurdeeinPatientmiteinem20

bis24StundenandauerndenKomaindasKrankenhauseingeliefert.DerPatienterholte

sichinnerhalbvon3-4Tagenvollständig.

Maßnahmen:

BeiakuterÜberdosierungmitTopiramatsolltebeikürzlichzurückliegenderEinnahme

de_7705 Mai 2010 Seite:12von17

ENR:2165072-2165075

unverzüglicheineMagenentleerungdurchMagenspülungoderInduktionvonErbrechen

herbeigeführtwerden.InvitroerwiessichAktivkohlealsAdsorbensvonTopiramat.

AllgemeinunterstützendeMaßnahmenundVorsichtsmaßnahmensindindiziert.Topiramat

kannmittelsHämodialysesehreffektivausdemBlutentferntwerden.Aufeine

ausreichendeFlüssigkeitszufuhrsolltegeachtetwerden.

5. PHARMAKOLOGISCHEEIGENSCHAFTEN

5.1 PharmakodynamischeEigenschaften

PharmakotherapeutischeGruppe:SonstigeAntiepileptika,Antimigränemittel.

ATC-Code:N03AX11

TopiramatisteinMonosaccharid-Sulfamat,dessenWirkungaufmehrerenEigenschaften

beruht:

TopiramatreduziertdieFrequenzdesAuftretensvonAktionspotentialennachder

DepolarisationvonNeuronen.DiesweistaufeinezustandsabhängigeBlockadeder

spannungsabhängigenNa-Kanälehin.

TopiramatantagonisiertschwachdieexzitatorischeWirkungvonGlutamatan

bestimmtenSubtypen(Kainat/AMPA)desGlutamat-Rezeptors.

TopiramaterhöhtdeutlichdieGABA-AktivitätanbestimmtenGABA

-Rezeptoren.

TopiramathatantikonvulsiveAktivitätimElektroschock-Krampftest(maximalelectro-

shockseizure(MES)test)anRattenundMäusen.Topiramatistnurschwach

wirksamhinsichtlichderBlockierungklonischerAnfälle,diedurchdenGABA

Rezeptor-AntagonistenPentylentetrazolhervorgerufenwerden.Topiramatist

ebenfallsinEpilepsie-ModellenanNagernwirksam,einschließlichtonischerund

Absence-ähnlicherAnfälleinderspontanepileptischenRatte(SER)undtonischer

undklonischerAnfälle,diebeiderRattedurchErregungderAmygdalaoderglobale

Ischämieinduziertwerden.

Topiramatwirktmodulierendauf"highvoltage"aktivierteCa-Kanäle.

AußerdembewirktTopiramateineHemmungeinigerIsoenzymeder

Carboanhydrase.DieseHemmungistallerdingsvielschwächerausgeprägtalsdie

desAcetazolamid,einembekanntenCarboanhydrase-Inhibitor.

DieWirksamkeitvonTopiramatinderMigräneprophylaxewurdeinzweimultizentrischen,

randomisierten,doppelblinden,placebokontroIliertenParallelgruppenstudienuntersucht.

DiegepooltenErgebnissederStudien,indenenTopiramat-Dosenvon50(n=233),100

(n=244)und200mg/Tag(n=228)untersuchtwurden,zeigteneinemedianeprozentuale

VerringerungdesprimärenWirksamkeitsendpunktes,derdurchschnittlichenmonatlichen

Migränephasenrateum35%,51%bzw.49%,verglichenmit21%inderPlacebogruppe

(n=229).DieTopiramat-Dosenvon100und200mgproTagwarenPlacebostatistisch

überlegen;dieUnterschiedefürdieDosisvon50mgproTaggegenüberPlacebowaren

dagegenstatistischnichtsignifikant.27%derPatienten,die100mgTopiramatproTag

erhielten,erreichteneineSenkungderMigränefrequenzvonmindestens75%(Placebo

11%),während52%eineReduktionvonmindestens50%erreichten(placebo23%).

Ineinerdrittenmultizentrischen,randomisierten,doppelblindenParallelgruppenstudie

wurdegezeigt,dassdiemonatlicheHäufigkeitderMigränephasen(derprimäreEndpunkt)

um-0.8PhasenproMonatverringertwurde,verglichenmitderAusgangsphaseunter

Placebo.DieVerringerungunter100mgTopiramatproTagbetrug-1.6PhasenproMonat

undunter200mgTopiramat-1.1PhasenproMonat.DieseUnterschiedewarenstatistisch

nichtsignifikant.

IneinerweiterenzusätzlichenStudiekonnteninderprimärenWirksamkeitsanalysekeine

statistischsignifIkantenUnterschiedezwischenderZieldosisvon200mgTopiramatund

de_7705 Mai 2010 Seite:13von17

ENR:2165072-2165075

Placebofestgestelltwerden(ÄnderungdermonatlichenMigräneepisodenrategegenüber

derAusgangsphase).

5.2 PharmakokinetischeEigenschaften

Topiramatwirdschnellresorbiert.NachderEinnahmevon400mgoralwerdenSpitzen-

plasmaspiegelnachetwa2Stundenerreicht.DiePharmakokinetikvonTopiramatistlinear,

miteinemdosisproportionalenAnstiegderPlasmakonzentrationimuntersuchten

Dosisbereich(200-800mg/Tag).DiemittlerePlasmaeliminationshalbwertszeitnacheiner

odermehrerenDosenbeträgt21Stunden.BeiPatientenmitnormalerNierenfunktionwird

einSteady-statedamitnachca.4Tagenerreicht.Topiramatwirdineinem

Konzentrationsbereichvon1-250µg/mlzu13-17%anhumanePlasmaproteine

gebunden.

Bioverfügbarkeit:

DierelativeBioverfügbarkeitvonTopiramatinTablettenformbeträgtca.80%verglichenmit

einerLösung.DieBioverfügbarkeitvonTopiramatwirddurchNahrungsaufnahmenicht

beeinflusst.EinVergleichderpharmakokinetischenParametervonKapselnundTabletten

zeigtekeinesignifikantenUnterschiede.DiebeidenDarreichungsformensind

bioäquivalent.

Metabolisierung und Ausscheidung:

TopiramatwirdnichtextensivmetabolisiertundprimärunverändertüberdenUrin

ausgeschieden(ca.70%dergegebenenDosis).EswurdensechsMetabolitebeim

Menschenidentifiziert,vondenenkeinerzumehrals5%zurappliziertenDosisbeiträgt.

DieMetabolitenwerdendurchHydroxylierung,HydrolyseundGlucuronidierunggebildet.

EsgibtHinweisefüreinetubuläreRückresorptionvonTopiramat.BeiRatten,denen

ProbenezidzurHemmungdertubulärenRückresorptionzusammenmitTopiramatgegeben

wurde,kameszueinemsignifikantenAnstiegderrenalenClearancevonTopiramat.Diese

InteraktionwurdenichtbeiMenschenuntersucht.Insgesamtbeträgtdieorale

PlasmaclearancebeimMenschennachoralerAnwendungca.20-30ml/min.

SpeziellePatientengruppen

Kinder:

DiegewichtsbezogeneClearancevonTopiramatistbeiKindernhöheralsbei

Erwachsenen.DieHalbwertszeitbeiKindernimAltervon2Jahrenbeträgtetwa7h,bei

Kindernzwischen4und17Jahrenetwa15h.DieSerumkonzentrationensindca.33%

niedrigeralsdiebeiErwachsenen(körpergewichtsbezogeneDosisvorausgesetzt).Bei

GabeenzyminduzierenderSubstanzenwieCarbamazepinoderPhenytoinwirddurcheine

ZunahmedesmetabolisiertenAnteilsdieEliminationshalbwertszeitweiterverkürzt.

EingeschränkteNierenfunktion:

VerglichenmitnormalerNierenfunktion(Kreatinin-Clearance>70ml/min/1,73m 2 )wurde

dieTopiramat-ClearancebeiPatientenmitmäßigerNiereninsuffizienz(Kreatinin-Clearance

30-69ml/min/1,73m 2 )um42%undbeiPatientenmitschwererNiereninsuffizienz

(Kreatinin-Clearance<30ml/min/1,73m2)um54%reduziert.Davermutetwird,dass

TopiramateinersignifikantentubulärenRückresorptionunterliegt,istunklar,obdiese

ErgebnisseaufalleFormenderNierenfunktionsstörungübertragenwerdenkönnen.Esist

denkbar,dasseinigeFormenvonNierenerkrankungendieglomeruläreFiltrationsrateund

tubuläreRückresorptionunterschiedlichbeeinflussen,waszueinervonderKreatinin-

ClearanceunabhängigenTopiramat-Clearanceführenkönnte.ImAllgemeinenistdieHälfte

derüblichenDosisbeiPatientenmitmäßigeroderschwererNiereninsuffizienzzu

empfehlen.

Hämodialyse:

TopiramatwirddurchHämodialyseentfernt.BeihocheffizienterDialyse("Single-pass-

System"inGegenführung)miteinemBlutflussvon400ml/mindurchdasDialysiergerät,

de_7705 Mai 2010 Seite:14von17

ENR:2165072-2165075

betrugdieTopiramat-Dialyse-Clearance120ml/min.DiesehoheClearance(verglichenmit

20-30ml/minoralerClearancebeigesundenErwachsenen)entfernteineklinisch

signifikanteMengeTopiramatwährendeinerDialysesitzungausdemKörper.Daherkann

eineDosisanpassungnotwendigsein(s.4.2"Dosierung,ArtundDauerderAnwendung").

EingeschränkteLeberfunktion:

BeiPatientenmiteingeschränkterLeberfunktionkanndieTopiramat-Clearance

herabgesetztsein;derzugrundeliegendeMechanismusistunklar.

5.3 PräklinischeDatenzurSicherheit

Akute Toxizität:

NachoralerAnwendunglagdieLD50beiMäusenundRattenoberhalbvon2300mg/kg

KG/TagundbeimHundoberhalbvon400mg/kgKG/Tag.

IneinerEinzeldosis-ToxizitätsstudieanTierenwarendieklinischenZeicheneinerakuten

VergiftungprimärZNS-bezogenundumfasstenAtaxie,vermindertemotorischeAktivität,

TremorundklonischeKonvulsionen.

Chronische Toxizität:

InStudienzurchronischenToxizitätmitTopiramatanMäusenundRattentraten

HyperplasienderMagenepithelzellen,ReduktionderParietalzellensowieAnstiegdes

Serumgastrinspiegelsauf,dienachAbsetzenderBehandlungreversibelwaren.

BeobachtetwurdenaußerdemAlkalisierungdesUrins,urothelialeMineralisierungund

SteinbildungsowienichtreversibleHyperplasiendesBlasenepithelsunddes

Nierenbeckenepithels.EineProgressionzuNeoplasientratnichtauf.Hundezeigtendiese

Effektenicht.DiegenanntenWirkungenwerdenaufdieCarboanhydrasehemmungdurch

Topiramatzurückgeführt,diebeiRattenweitausstärkeralsbeimMenschenausgeprägtzu

seinscheint(nachpharmakologischenUntersuchungen).

BeobachteteLebergewichtserhöhungen(Hund,Ratte,Maus)sowiecentrilobuläre

HypertrophieundeosinophileFoci(Ratte,Maus)lassensichdurchEnzyminduktionnach

hohenDosenvonTopiramaterklären.

WeitereaufdieCarboanhydrase-hemmendeWirkungzurückzuführendeEffektewaren:

AbnahmevonHämatokrit,HämoglobinundErythrozyten(Ratte,Hund),wahrscheinlich

bedingtdurchHämodilution;verstärkteWasseraufnahme,Diurese,Veränderungender

Ionenexkretion(Na + ,K + ,Cl - )imUrin(Ratte),ErhöhungenderSerumchloridwerteundAbfall

derSerumkaliumwerte(Hund).

Tumorerzeugendes Potential:

RattenzeigtenkeineerhöhteTumorinzidenznachTopiramatgabevonmax.120mg/kg/Tag

über24Monate.EineerhöhteAnzahlvonBlasentumorenwurdebeiMäusenbesondersin

derhöchstenDosisgruppe(300mg/kg)beobachtet.DaBlasentumorendieses

histomorphologischenTypsbishernichtbeianderenSäugetierarteneinschließlichdem

Menschenbeobachtetwurden,werdensiealsklinischnichtrelevanteingestuft.

Mutagenität:

TopiramatwurdeeinerVielzahlverschiedenerin-vitro-undin-vivo-Untersuchungen

unterzogen.DiedurchgeführtenTestsergabenkeinenHinweisaufeinmutagenesPotential

(Genmutationen,Chromosomenaberrationen).

Reproduktionstoxizität:

BeiMäusen,RattenundKaninchenistTopiramatteratogenundembryotoxisch.BeiRatten

istTopiramatplazentagängig.DieteratogenenEffektewarendenenanderer

Carboanhydrase-Inhibitorenähnlich,diebishernichtmitMissbildungenbeimMenschenin

Verbindunggebrachtwurden.NachteiligeAuswirkungenvonTopiramataufFertilität,

Paarungsverhalten,TrächtigkeitoderdieAufzuchtderJungtierewarimTierversuchnicht

erkennbar.

de_7705 Mai 2010 Seite:15von17

ENR:2165072-2165075

6. PHARMAZEUTISCHEANGABEN

6.1 ListedersonstigenBestandteile

TopiramatPremierResearch25mg/-50mg/-100mg/-200mgFilmtabletten:

Tablettenkern:

MikrokristallineCellulose

PovidonK29-32

HochdispersesSiliciumdioxid

Carboxymethylstärke-NatriumTypA(Ph.Eur.)

Magnesiumstearat(Ph.Eur.)

Filmüberzug:

TopiramatPremierResearch25mgFilmtablettenzusätzlich:

Titandioxid(E171)

Hypomellose

Macrogol400

Polysorbat80

TopiramatPremierResearch-50mg/-100mgFilmtablettenzusätzlich:

Titandioxid(E171)

Hypomellose

Macrogol400

Eisen(III)hydroxid-oxidxH

TopiramatPremierResearch-200mgFilmtablettenzusätzlich:

Titandioxid(E171)

Hypomellose

Macrogol400

FarbstoffAllurarot(E129)

GelborangeS,Aluminiumsalz(E110)

Indigocarmin,Aluminiumsalz(E132)

6.2 Inkompatibilitäten

Nichtzutreffend.

6.3 DauerderHaltbarkeit

3Jahre

6.4 BesondereVorsichtsmaßnahmenfürdieAufbewahrung

InderOriginalverpackungaufbewahren.

6.5 ArtundInhaltdesBehältnisses

TopiramatPremierResearch25mg/-50mg/-100mg/-200mgFilmtabletten:

Blisterpackungenmit10,20,28,50,100und200Filmtabletten

UnverkäuflichesMuster:TablettenbehältnisoderBlisterpackungmit10Filmtabletten

6.6 BesondereVorsichtsmaßnahmenfürdieBeseitigung

KeinebesonderenAnforderungen.

de_7705 Mai 2010 Seite:16von17

ENR:2165072-2165075

7. InhaberderZulassungen

MylanduraGmbH

Wittichstraße6

64295Darmstadt

8. Zulassungsnummern

66072.00.00(25mg)

66073.00.00(50mg)

66074.00.00(100mg)

66075.00.00(200mg)

9. DatumderErteilungderZulassungen/VerlängerungderZulassungen

19April2010

10.StandderInformation

Mai2010

11.Verkaufsabgrenzung

Verschreibungspflichtig.

de_7705 Mai 2010 Seite:17von17

Ähnliche Produkte

Suchen Sie nach Benachrichtigungen zu diesem Produkt

Teilen Sie diese Informationen