NOTTA 10 MG 28 FILM TABLET

Genel Bilgiler

  • Ticaret Unvanı:
  • NOTTA 10 MG 28 FILM TABLET
  • Reçete türü:
  • Normal
  • İçin kullanmak:
  • İnsanlar
  • İlaç türü:
  • allopatik ilaç

Belgeler

Yerelleştirme

  • Bulunduğu ülkeler::
  • NOTTA 10 MG 28 FILM TABLET
    Türkiye
  • Dil:
  • Türkçe

Terapötik bilgiler

  • Terapötik alanı:
  • montelukast

Diğer bilgiler

Durum

  • Kaynak:
  • TİTCK - TÜRKİYE İLAÇ VE TIBBİ CİHAZ KURUMU - Türkiye
  • Yetkilendirme durumu:
  • Aktif
  • Yetkilendirme numarası:
  • 8680833090014
  • Yetkilendirme tarihi:
  • 05-05-2015
  • Son Güncelleme:
  • 25-05-2018

Hasta Bilgi broşürü: Ürün Özellikleri Özeti - kompozisyon, endikasyonlar, yan etkiler, dozaj, etkileşimleri, advers reaksiyonlar, gebelik, laktasyon

KULLANMATALİMATI

NOTTA10mgfilmtablet

Ağızdanalınır.

Etkinmadde:10 mgmontelukast(10.40mgmontelukast sodyum olarak)içerir.

Yardımcımaddeler:Hidroksipropilselüloz,mikrokristalselüloz,laktozmonohidrat,

kroskarmelossodyum, magnezyum stearat,hidroksipropil metilselüloz2910, titanyumdioksit

(E171), sarıdemiroksit(E172), kırmızıdemiroksit(E172).

Builacıkullanmaya başlamadanöncebuKULLANMATALİMATINIdikkatlice

okuyunuz,çünkü sizin için önemlibilgileriçermektedir.

Bu kullanma talimatınısaklayınız. Daha sonra tekrarokumaya ihtiyaçduyabilirsiniz.

Eğerilavesorularınızolursa, lütfen doktorunuza veya eczacınıza danışınız.

Bu ilaçkişiselolaraksizin için reçeteedilmiştir, başkalarına vermeyiniz.

Bu ilacın kullanımısırasında, doktora veya hastaneyegittiğinizdedoktorunuza bu ilacı

kullandığınızısöyleyiniz.

Bu talimatta yazılanlara aynen uyunuz. İlaçhakkında sizeönerilen dozun dışında

yüksek veya düşükdozkullanmayınız.

BuKullanma Talimatında:

1.NOTTAnedirveneiçink ullanılır?

2.NOTTA’ yıkullanmadanöncedikkatedilmesigerekenler

3.NOTTA nasılkullanılır?

4. Olasıyanetkilernelerdir?

5.NOTTA’ nınsaklanması

Başlıklarıyeralmaktadır.

1. NOTTAnedir ve neiçinkullanılır?

NOTTAlökotrienleradıverilenmaddeleriengelleyenbirlökotrienalıcısı(reseptör)

antagonistidir(karşıtetkigösteren).Lökotrienleriengelleyerekastımbelirtileriniiyileştirirve

alerjiknezleyiiyileştirir.

NOTTAsteroid(kole sterolleilişkili,yağyapıdabirorganikbileşik)değildir.Çalışmalar

NOTTA’nınçocuklarınbüyümehızınıetkilemediğinigöstermiştir(astımvealerjiknezle

(rinit)hakkındadahafazlabilgiilerikibölümlerdeyeralmaktadır).

NOTTAinatçıastımıntedavisi vealerjiknezlenin(rinitin)belirtileriningiderilmesi için

reçetelenir:

Astım:

NOTTA15yaşvedahabüyükçocuklardaveerişkinlerdeinatçıastımıntedavisinde

kullanılmalıdır.

NOTTA’yıbirastımatağındakısasüreliiyileşmesağlamakiçinkullanmayın.Astım

atağıyaşadığınızdadoktorunuzunastımataklarınıntedavisiiçinsizesöyledikleriniyapmanız

gerekir.

AlerjikRinit:

NOTTAalerjikrinitbelirtilerinin(hapşırık,buruntıkanıklığı,burunakıntısıvekaşıntısı)

kontrolüneyardımcıolmak amacıylakullanılır. NOTTAfilm tablet, 15yaşveüzerihastalarda

mevsimselalerjikrinitvepereniyalalerjikrinit(yılboyudevameden)semptomlarının

giderilmesiiçinkullanılır.

NOTTA 28ve90 tabletlikambalajlardakullanımasunulmuştur.Herbirtabletiniçinde10mg

etkin madde(montelukast)bulunmaktadır.

Astımnedir?

Astımvücudundışındakihavayıakciğerleretaşıyantüplerolanbronşiyalhavayollarında

sürekli(kronik)birenflamasyondur.Astımbelirtilerişunlardır:

Öksürük

Hırıltılısolunum

Göğüssıkışması

Nefesdarlığı

Alerjikrinitnedir?

Samannezlesiolarakdabilinenmevsimselalerjikrinitağaç,çimenveotpolenlerigibiev

dışındabulunan alerjenleriletetiklenir.

Uzun süredevameden (pereniyal)alerjik rin ityılboyugörülebilirvegenellikleevtozu

akarları, hayvan tüyü kepeğive/veyaküfsporlarıgibiev içindekialerjenleriletetiklenir.

Alerjikrinitbelirtileriaşağıdakileriiçerebilir:

- Burun tıkanıklığı, akıntısıve/veyakaşıntısı

- Hapşırık

2. NOTTA’ yıkullanmadan öncedikkatedilmesigerekenler

NOTTA’ yıaşağıdakidurumlardaKULLANMAYINIZ

Eğer;

Montelukastveyailacınherhangibirbileşeninekarşıalerjikseniz(aşırıduyarlılığınızvar

ise),

NOTTA’ yıaşağıdakidurumlardaDİKKATLİKULLANINIZ

Eğer;

Astımınızveyasolunumunuzkötüleşirse, derhaldoktorunuzasöyleyiniz.

OralNOTTAakutast ımataklarının tedavisindekullanılmak üzeretasarlanmamıştır.Biratak

şarsanızdoktorunuzunsizeverdiği talimatlarauyunuz.Astımataklarıiçinaldığınız

kurtar ıcıinhaleilacınızıherzamanyanınızdabulundurunuz.

Sizinveyaçocuğunuzuntümastımilaçlarınıdoktorunuztarafındanbelirtilenşekilde

almanızönemlidir.NOTTAdoktorunuzunsizereçetelediğidiğerastımilaçlarınınyerine

kullanılmamalıdır.

Ast ımkarşıtıilaçlaralantümhastalargribalhastalık, kollardaveyabacaklardauyuşukluk

veya kar ıncalanma,akciğersemptomlarındakötüleşmeve/veyadöküntü olaylarının

kombinasyonunu ya şadıklarındadoktorlarına başvurmalarıgerektiğikonusunda

uyar ılmalıdır.

Astımınızvarsaveastımınızasetilsalisilikasit(aspirin)alıncakötüleşiyorsa,NOTTA

alırkenaspirinveyasteroidolmayanantienflamatuvarilaçlaradıverilenağrıkesicidiğer

ilaçlarıkullanmamayaçalışın.

NOTTAkullanımısırasındaduygudurumdeğişiklikleri(saldırgandavranışlarveya

düşmanlıkhissetmeyiiçerenajitasyon,endişehissetme,depresyon,disoryantasyon,

kabuslarıiçerenrüyaanormallikleri,halüsinasyonlar,uyumadazorlanma,huzursuzluk,

hareketlilik,uyurgezerlik,intihardü şüncesivedavranışı(intihargirişimidahil)vetremor)

bildirilmiştir.Hastalar,butürdeğişikliklerilekarşılaşmalarıhalindedoktorlarını

bilgilendirmelerigerektiğikonusundauyarılmalıdır.

Buuyarılargeçmiştekiherhangibirdönemdedahiolsasiziniçingeçerliyse lütfen

doktorunuzadanışınız.

NOTTA ’nınyiyecekveiçecekilekullanılması

NOTTA10 mggıdalarlabirlikteveyaayrıolarakalınabilir.

Hamilelik

İlacıkullanmadan öncedoktorunuza veyaeczacınıza danışınız.

Hamileysenizveya çocuksahibi olmay ıplanlıyorsanız, NOTTAalmadanöncedoktorlarına

ışmalıdır. Doktorunuzbu dönemdeNOTTAkullanıpkullanamayacağınızı

ğerlendirecektir.

Tedavinizsırasında hamileolduğunuzufarkedersenizhemen doktorunuzadanışınız.

Emzirme

İlacıkullanmadan öncedoktorunuza veyaeczacınıza danışınız.

NOTTA’nın annesütünegeçipgeçmediğibilinmemektedir.Emziriyorsanız veya bebeğinizi

emzirmeyi d üşünüyorsanız, NOTTAalmadan öncedoktorunuzadanışmalısınız.

Araçvemakine kullanımı

NOTTA’nınaraçveyamakinekullanmabecerinizietkilemesibeklenmez.Ancakkişilerin

ilaçlaraverdiğiyanıtlarfarklıolabilir.NOTTAileçokenderbildirilenbelirliyanetkiler(baş

dönmesiveuyuklama)bazıhastaların araçveyamakinekullanmabecerisinietkileyebilir.

NOTT A’nıniçeriğindebulunanbazıyardımcımaddelerhakkında önemlibilgiler

NOTTAlaktoziçerir. Eğerdahaöncedendoktorunuztarafındanbazışekerlerekarşı

intoleransınızolduğu söylenmişsebu tıbbiürünü almadan öncedoktorunuzlatemasageçiniz.

NOTTA herdozunda23mg’dan dahaazsodyumihtivaeder. Dozu nedeniileherhangibir

uyarıgerekmemektedir.

Diğerilaçlarilebirliktekullanımı

ıilaçlarNOTTA’nınetkimekanizmasınıdeğiştirebilirveyaNOTTAdiğerilaçlarınızın

etki mekanizmas ınıdeğiştirebilir.Eğeraşağıdaki ilaçlarıalıyorsanız,NOTTA’yabaşlamadan

öncebunlar ıdoktorunuzasöyleyiniz:

fenobarbital (epilepsi tedavisi içinkullan ılır)

fenitoin(epilepsi tedavisi içinkullan ılır)

rifampisin (tüberkülozvebaz ıdiğerenfeksiyonlarıntedavisi için kullanılır)

gemfibrozil (kan ın hücrelerharicindekisıvıkısmındayeralan yüksek yağdüzeyinin

tedavisi içinkullan ılır)

Eğerreçeteliyadareçetesizherhangibirilacışuandakullanıyorsanızveyasonzamanlarda

kullandınıziselütfen doktorunuza veya eczacınıza bunlarhakkında bilgiveriniz.

3. NOTTA nasılkullanılır?

Uygunkullanımvedoz/uygulama sıklığıiçintalimatlar:

Astımlıçocuklar(15 yaşveüzeri):

NOTTA10 mgfilm tableti çocuğunuzagündebirkezakşamlarıverin(bkz.Uygulama

yolu vemetodu).Öğün zamanlarından bağımsızolarak verebilirsiniz.

NOTTA’ yıastımbelirtileriyaşamasabile,doktorunuzsizereçetelediğisürecehergün

çocuğunuzavermelisiniz.

Astımbelirtilerikötüleşirseveyaastımataklarıiçinalınankurtarıcıinhaleilacıçocuğunuz

için dahafazlakullanmanızgerekirsederhaldoktorunuzu arayınız.

NOTTA’ yıbirastımatağında kısa süreliiyileşmesağlamakiçinkullanmayın.

Çocuğunuzastımatağıyaşadığındadoktorunuzunastımataklarınıntedavisiiçinsize

söyledikleriniyapmanızgerekir.

Astımataklarıiçinçocuğunuzunkurtarıcıinhaleilacınızıherzamanyanınızda

bulundurunuz.

Doktorunuzsizesöylemedikçediğerastımilaçlarınıçocuğunuzavermeyibırakmayınız

veyadozunuzu azaltmayınız.

Mevsimselvepereniyalalerjik rinitlierişkinlerde(15 yaşveüzeri):

NOTTA' yıgündebirkezvegeneldeaynısaattealınız.

NOTTA’ yıdoktorunuzreçetelediğisürecegündebirkezalınız.

Öğün zamanlarından bağımsızolarakverebilirsiniz.

Uygulama yoluvemetodu:

NOTTAsadeceağızyoluylaalınır.

Açkarnınaveyayiyeceklerlebirliktealabilirsiniz.

Tabletleriçiğnemedenyeterlimiktardasıvıilealınız(örneğin, birbardak suile).

Değişikyaşgrupları:

Çocuklarda kullanımı:

2- 5yaşarasıçocuklariçin NOTTA4 mgçiğnemetableti,

6- 14yaşarasıçocuklariçin NOTTA5 mgçiğnemetabletikullanılabilir.

Yaşlılardakullanımı:

Yaşabağlıolarak özeldozayarlamasıgerekmemektedir.

Özelkullanımdurumları:

Böbrek/Karaci ğeryetmezliği:

Böbrekyetmezliğiolanhastalardadozayarlamasıyapmayagerekyoktur.Hafif-orta derecede

karaciğeryetmezliğiolanhastalardadozayarlamasıgerekmez.Ciddikaraciğeryetmezliği

olan hastalarailişkin veriyoktur.

EğerNOTTA’nınetkisininçokgüçlüveyazayıfolduğunadairbirizleniminiz var ise

doktorunuzveyaeczacınızilekonuşunuz.

K ullanmanızgerekendendahafazlaNOTTAkullandıysanız:

Doza şımıraporlarınınçoğundahiçbiryanetki bildirilmemiştir.Yetişkinlerdeveçocuklarda

doza şımıylabirlikteensıkbildirilensemptomlarkarındaağrı, uyku hali, susama, başağrısı,

kusmave aşırıhareketlilik.

NOTTA’da nkullanmanızgerekendenfazlasınıkullanmışsanızbirdoktorveyaeczacıile

konuşunuz.

NOTTA’ yıkullanmayıunutursanız:

İlacınızıtavsiyeedilenşekildealmayaçalışınız.

İlacıbirdozalmayıunuttuğunuzda,budozualmayınızvedahasonranormalkullanıma

devamediniz.

Unutulan dozlarıdengelemekiçin çiftdozalmayınız.

NOTTAiletedavisonland ırıldığında oluşabileceketkiler

ğerNOTTAalmaya devamederseniz,ilaç sadece astımınızıtedavi edebilir.

NOTTA’yıdoktorunuzun reçetelediğisüre boyuncaalmanızönemlidir.NOTTAastımınızı

kontroletmeyeyard ımcıolacaktır.

Bu ürünün kullan ımıileilgili herhangi birilavesorunuzolursa, doktorunuzaveya eczacınıza

ışınız.

4. Olasıyanetkilernelerdir?

TümilaçlargibiNOTTA’nıniçeriğindebulunanmaddelereduyarlıolan kişilerdeyanetkiler

olabilir.Montelukast 10mgfilm tabletile yap ılan klinikçalışmalardaenyaygınşekilde

bildirilen (tedaviedilen100 hastadan en azbirindevetedaviedilen 10 hastadan <1 'inde

görülen)vemontelukastileili şkili olduğu düşünülenyanetkilerşunlardır:

Karınağrısı

Başağrısı

NOTTA'nınyanetkilerigenelliklehafiftirvemontelukastile tedaviedilenhastalarda

plaseboya(ilaç içermeyentablet)göre dahayükseks ıklıktaortayaçıktılar.

Yanetkileraşağıdakikategorilerdegösterildiğişekildetanımlanmıştır:

Çokyayg ın:10 hastadanen az1 'indegörülür.

Yayg ın:100 hastadan 1-10'undagörülür.

Yayg ın olmayan:1000 hastadan 1-10'undagörülür.

Seyrek:10.000 hastadan1-10'undagörülür.

Çok seyrek:10.000 hastadan birinden azgörülür.

ıca,ilacınpazarlandığıdönemdeaşağıdaki olaylarbildirilmiştir:

Çokyayg ın:

-Üstsolunumyoluenfeksiyonu

Yayg ın:

-Diyare, bulant ı, kusma

-Döküntü

-Ate ş

- Karaciğerenzimlerindeyükselme

Yayg ın olmayan:

-Alerjik reaksiyonlar[yüz, dudaklar, dilve/veyabo ğazdaşişme(solumaveyayutma

zorlu ğuyaratabilir)]

-Davran ışveruh halideğişiklikleri (kabuslardahilrüyaanormallikleri,uykuya

dalmadagüçlük, uyurgezerlik, sinirlilikveyauyarıyaaşırıtepkigösterme,endişeli

hissetme, huzursuzluk,sinirlidavran ışvedüşmanlık içeren huzursuzluk hali

(ajitasyon), depresyon

-Ba şdönmesi, uyuklama, karıncalanma/uyuşma,nöbetler[konvülsiyonlar(kasların

istemd ışıkasılması) veyakrizler]

-Burunkanamas ı

-A ğızkuruluğu,hazımsızlık, morluklar, kaşıntı, ürtiker

-Eklemya da kasa ğrısı, kaskrampları

- Bitkinlik/halsizlik,kendiniiyihissetmeme,şişlik

Seyrek:

-Kanama e ğilimindeartış,

-Çarp ıntı

- Dikkateksikliği

- Unutkanlık

Çok seyrek:

-Halüsinasyonlar(gerçektevarolmayan şeylergörmek)

-Disoryantasyon(zaman-mekanbilinciniyitirme)

- İntihardüşüncesive davranışı(intihardahil)

-Hepatit(karaci ğeriltihabı)

-Cildinalt ındaveen sık olarak incik kemiğinizin üzerindekibölgedekırmızı,

dokununcaa ğrıyankırmızışişlikler(eritemanodozum), hiçbirbelirtivermeden aniden

ortaya çıkanşiddetli deri reaksiyonları(eritemamultiforıne)

Montelukast iletedavi edilenhastalardagribalhastal ık, kollardaveyabacaklardauyuşukluk

veyakar ıncalanma,akciğersemptomlarındakötüleşmeve/veyadöküntü (Churg-Strauss

Sendromu)olaylar ınınkombinasyonunu içeren çok nadirolgularbildirilmiştir. Bu

semptomlardan biriniveyadahafazlas ınıyaşarsanızdoktorunuza söylemelisiniz.

Eğerbukullanmatalimatındabahsigeçmeyenherhangibiryanetkiilekarşılaşırsanız

doktorunuzu veyaeczacınızıbilgilendiriniz.

Yanetkilerinraporlanması

KullanmaTalimatındayeralanveyaalmayanherhangibiryanetkimeydanagelmesi

durumundahekiminiz,eczacınızveyahemşirenizilekonuşunuz.Ayrıcakarşılaştığınızyan

etkileriwww.titck.gov.trsitesindeyeralan“İlaçYanEtkiBildirimi”ikonunatıklayarakyada

08003140008numaralıyanetkibildirimhattınıarayarakTürkiyeFarmakovijilansMerkezi

(TÜFAM)'nebildiriniz.Meydanagelenyanetkileribildirerekkullanmaktaolduğunuzilacın

güvenliliğihakkındadahafazlabilgiedinilmesinekatkısağlamışolacaksınız.

5. NOTTA ’nınsaklanması

NOTTA’ yıçocukların göremeyeceği,erişemeyeceğiyerlerdeveambalajında saklayınız.

25 °C’nin altındakiodasıcaklığındasaklayınız.

Sonkullanma tarihiyleuyumluolarakkullanınız.

Ambalajdakison kullanma tarihindensonraNOTTA’ yıkullanmayınız.

Eğerüründeve/veyaambalajındabozukluklarfark edersenizNOTTA’yıkullanmayınız.

Ruhsatsahibi:

Adı: ArvenİlaçSan. veTic.A.Ş.

Adresi: İstinyeMahallesi,BalabandereCaddesi, No:14,34460 Sarıyer/İstanbul

Tel :0 212 362 18 00

Faks :0 212362 17 38

Üretimyeri:

Adı

: SanovelİlaçSan. veTic. A.Ş.

Adresi: Balaban Mahallesi, CihanerSokağı, No:10, 34580 Silivri/İstanbul

Telefon:0 212 746 52 52

Faks :0 212 746 53 94

Bu kullanma talimatı13.10.2014tarihindeonaylanmıştır.

Document Outline

4-12-2018

Mylan Expands Its Voluntary Nationwide Recall of Valsartan Tablets, USP, Amlodipine and Valsartan Tablets, USP, and Valsartan and Hydrochlorothiazide Tablets, USP, to all Lots Within Expiry Due to The Detection of Trace Amounts of NDEA (N-Nitrosodiethylam

Mylan Expands Its Voluntary Nationwide Recall of Valsartan Tablets, USP, Amlodipine and Valsartan Tablets, USP, and Valsartan and Hydrochlorothiazide Tablets, USP, to all Lots Within Expiry Due to The Detection of Trace Amounts of NDEA (N-Nitrosodiethylam

– Mylan N.V. (NASDAQ: MYL) today announced that its U.S. based Mylan Pharmaceuticals business is expanding its consumer-level voluntary nationwide recall to include all lots of Valsartan-containing products within expiry. The 104 additional lots include 26 lots of Amlodipine and Valsartan Tablets, USP (including the 5mg/160mg, 10mg/160mg, 5mg/320mg and 10mg/320mg strengths), 51 lots of Valsartan Tablets, USP (including 40 mg, 80 mg, 160 mg and 320 mg strengths), and 27 lots of Valsartan and Hydrochloroth...

FDA - U.S. Food and Drug Administration

21-11-2018

Fresenius Kabi Issues Voluntary Nationwide Recall of Sodium Chloride Injection, USP, 0.9% Due to Product Labeling Incorrectly Stating Stoppers Do Not Contain Latex

Fresenius Kabi Issues Voluntary Nationwide Recall of Sodium Chloride Injection, USP, 0.9% Due to Product Labeling Incorrectly Stating Stoppers Do Not Contain Latex

Fresenius Kabi USA is voluntarily recalling 163 lots of Sodium Chloride Injection, USP, 0.9%, 10 mL fill in a 10 mL vial and Sodium Chloride Injection, USP, 0.9%, 20 mL fill in a 20 mL vial to the user level. The product insert states that stoppers for both the 10mL and the 20mL vials do not contain natural rubber latex; the tray label for the two vial sizes and the vial label for the 20mL vial also state that the stoppers do not contain latex. The product is being recalled because the stoppers contain n...

FDA - U.S. Food and Drug Administration

21-11-2018

Mylan Initiates Voluntary Nationwide Recall of 15 Lots of Valsartan Tablets, USP, Amlodipine and Valsartan Tablets, USP, and Valsartan and Hydrochlorothiazide Tablets, USP, Due to the Detection of Trace Amounts of NDEA (N-Nitrosodiethylamine) Impurity Fou

Mylan Initiates Voluntary Nationwide Recall of 15 Lots of Valsartan Tablets, USP, Amlodipine and Valsartan Tablets, USP, and Valsartan and Hydrochlorothiazide Tablets, USP, Due to the Detection of Trace Amounts of NDEA (N-Nitrosodiethylamine) Impurity Fou

Mylan N.V. (NASDAQ: MYL) today announced that its U.S. based Mylan Pharmaceuticals business is conducting a voluntary nationwide recall to the consumer level of select lots of Valsartan-containing products, including six lots of Amlodipine and Valsartan Tablets, USP (including the 5mg/160mg, 10mg/160mg, and 10mg/320mg strengths), seven lots of Valsartan Tablets, USP (including 40 mg, 80 mg, 160 mg, and 320 mg strengths), and two lots of Valsartan and Hydrochlorothiazide Tablets, USP 320mg/25mg strength. ...

FDA - U.S. Food and Drug Administration

7-9-2018

Camber Pharmaceuticals, Inc. Issues Voluntary Nationwide Recall of Montelukast Tablets USP, 10mg 30Ct. due to Product/Label Mix-Up

Camber Pharmaceuticals, Inc. Issues Voluntary Nationwide Recall of Montelukast Tablets USP, 10mg 30Ct. due to Product/Label Mix-Up

Camber Pharmaceuticals, Inc. is voluntarily recalling one single lot of Montelukast Sodium Tablets, USP 10mg, to the consumer level. This recall of one batch of Montelukast Sodium Tablets, USP 10mg, lot# MON17384 Exp. 12/31/2019, was prompted because a complaint of a sealed bottle labeled as Montelukast 10mg 30 ct found to contain 90 tablets of Losartan Potassium Tablets, USP 50mg

FDA - U.S. Food and Drug Administration

31-8-2018

FDA announces voluntary recall of Montelukast tablets by Camber Pharmaceuticals due to incorrect drug in bottles

FDA announces voluntary recall of Montelukast tablets by Camber Pharmaceuticals due to incorrect drug in bottles

FDA is warning the public about a voluntary recall of one lot of montelukast sodium tablets made by Camber Pharmaceuticals due to incorrect drug in bottles

FDA - U.S. Food and Drug Administration

29-8-2018

Protocol for the scientific opinion on the Tolerable Upper Intake Level of dietary sugars

Protocol for the scientific opinion on the Tolerable Upper Intake Level of dietary sugars

Published on: Fri, 10 Aug 2018 00:00:00 +0200 In June 2016, EFSA received a mandate from the national food competent authorities of five European countries (Denmark, Finland, Iceland, Norway and Sweden) to provide a dietary reference value (DRV) for sugars, with particular attention to added sugars. A draft protocol was developed with the aim of defining as much as possible beforehand the strategy that will be applied for collecting data, appraising the relevant evidence, and analysing and integrating t...

Europe - EFSA - European Food Safety Authority Publications

3-8-2018

Scientific guideline:  Ledipasvir/sofosbuvir film-coated tablet 90 mg/400 mg product-specific bioequivalence guidance, adopted

Scientific guideline: Ledipasvir/sofosbuvir film-coated tablet 90 mg/400 mg product-specific bioequivalence guidance, adopted

Ledipasvir/sofosbuvir film-coated tablet 90 mg/400 mg product-specific bioequivalence guidance

Europe - EFSA - European Food Safety Authority EFSA Journal

12-7-2018

Montelukast

Montelukast

Safety review

Therapeutic Goods Administration - Australia

30-4-2018

Stonewall Kitchen Voluntarily Recalls a Limited Amount of Basil Pesto Aioli due to Mislabeling and Undeclared Presence of the Dairy Allergen, Egg

Stonewall Kitchen Voluntarily Recalls a Limited Amount of Basil Pesto Aioli due to Mislabeling and Undeclared Presence of the Dairy Allergen, Egg

Stonewall Kitchen is voluntarily recalling a limited amount of 10.25oz Basil Pesto Aioli with an Enjoy By date of 28 Sep 2019 which may contain the undeclared allergen egg, as we may have inadvertently placed the label for our Basil Pesto on a small portion of our most recent production run.

FDA - U.S. Food and Drug Administration

21-2-2017

Takeda Pharma A/S recalls batch of Pamol® in packs of 300 film-coated tablets

Takeda Pharma A/S recalls batch of Pamol® in packs of 300 film-coated tablets

Takeda Pharma A/S recalls a batch of Pamol® in packs of 300 film-coated tablets after the discovery of Ibumetin 600 mg containing ibuprofen in some packs. Both types of medicine are used for the treatment of mild pain, but they work in different ways and may cause different adverse reactions.

Danish Medicines Agency

28-11-2018

PHEBURANE (Eurocept International BV)

PHEBURANE (Eurocept International BV)

PHEBURANE (Active substance: Sodium Phenylbutyrate) - Centralised - Transfer Marketing Authorisation Holder - Commission Decision (2018)8043 of Wed, 28 Nov 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/2500/T/20

Europe -DG Health and Food Safety

26-9-2018

Kexxtone (Elanco GmbH)

Kexxtone (Elanco GmbH)

Kexxtone (Active substance: Monensin sodium) - Centralised - Transfer Marketing Authorisation Holder - Commission Decision (2018)6324 of Wed, 26 Sep 2018 European Medicines Agency (EMA) procedure number: EMEA/V/C/2235/T/10

Europe -DG Health and Food Safety

10-8-2018

Sivextro (Merck Sharp and Dohme B.V.)

Sivextro (Merck Sharp and Dohme B.V.)

Sivextro (Active substance: tedizolid phosphate) - Centralised - Transfer Marketing Authorisation Holder - Commission Decision (2018)5522 of Fri, 10 Aug 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/2846/T/28

Europe -DG Health and Food Safety

3-8-2018

Sodium oxybate

Sodium oxybate

Sodium oxybate (Active substance: Sodium oxybate) - Centralised - Art 28 - (PSUR - Commission Decision (2018)5381 of Fri, 03 Aug 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/PSUSA/10612/201710

Europe -DG Health and Food Safety

10-7-2018

Adrovance (Merck Sharp and Dohme B.V.)

Adrovance (Merck Sharp and Dohme B.V.)

Adrovance (Active substance: Alendronate sodium / Colecalciferol) - Centralised - Transfer Marketing Authorisation Holder - Commission Decision (2018)4477 of Tue, 10 Jul 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/759/T/39

Europe -DG Health and Food Safety

10-7-2018

Ammonaps (Swedish Orphan Biovitrum International AB)

Ammonaps (Swedish Orphan Biovitrum International AB)

Ammonaps (Active substance: Sodium phenylbutyrate) - Centralised - Yearly update - Commission Decision (2018)4483 of Tue, 10 Jul 2018

Europe -DG Health and Food Safety

28-3-2018

EU/3/17/1876 (FGK Representative Service GmbH)

EU/3/17/1876 (FGK Representative Service GmbH)

EU/3/17/1876 (Active substance: Sodium (1R,3R,4R,5S)-3-({2-N-acetylamino-2-deoxy-3-O-[(1S)-1-carboxylato-2-cyclohexylethyl]-beta-D-galactopyranosyl}oxy)-4-({6-deoxy-alpha-L-galactopyranosyl}oxy)-5-ethyl-cyclohexan-1-yl-(38-oxo-2,5,8,11,14,17,20,23,26,29,32,35-dodecaoxa-39-azahentetracontan-41-yl)carboxamide) - Transfer of orphan designation - Commission Decision (2018)2011 of Wed, 28 Mar 2018 European Medicines Agency (EMA) procedure number: EMA/OD/010/17/T/01

Europe -DG Health and Food Safety

28-3-2018

EU/3/10/803 (Astellas Pharma Europe B.V.)

EU/3/10/803 (Astellas Pharma Europe B.V.)

EU/3/10/803 (Active substance: Chimeric monoclonal antibody against claudin-18 splice variant 2) - Transfer of orphan designation - Commission Decision (2018)2007 of Wed, 28 Mar 2018 European Medicines Agency (EMA) procedure number: EMA/OD/083/10/T/01

Europe -DG Health and Food Safety