HUMALOG

Genel Bilgiler

  • Ticaret Unvanı:
  • HUMALOG MIX 50 KWIKPEN 100IU/ML SC KULLANIMA HAZIR SUS.ICEREN ENJ.KALEMI (5 ENJEKSIYON KALEMI)
  • Reçete türü:
  • Normal
  • İçin kullanmak:
  • İnsanlar
  • İlaç türü:
  • allopatik ilaç

Belgeler

Yerelleştirme

  • Bulunduğu ülkeler::
  • HUMALOG MIX 50 KWIKPEN 100IU/ML SC KULLANIMA HAZIR SUS.ICEREN ENJ.KALEMI (5 ENJEKSIYON KALEMI)
    Türkiye
  • Dil:
  • Türkçe

Terapötik bilgiler

  • Terapötik alanı:
  • kombinasyonları

Diğer bilgiler

Durum

  • Kaynak:
  • TİTCK - TÜRKİYE İLAÇ VE TIBBİ CİHAZ KURUMU - Türkiye
  • Yetkilendirme durumu:
  • Aktif
  • Yetkilendirme numarası:
  • 8699673954288
  • Yetkilendirme tarihi:
  • 29-01-2013
  • Son Güncelleme:
  • 24-05-2018

Hasta Bilgi broşürü: Ürün Özellikleri Özeti - kompozisyon, endikasyonlar, yan etkiler, dozaj, etkileşimleri, advers reaksiyonlar, gebelik, laktasyon

KULLANMATALİMATI

HUMALOGMIX25

KWIKPEN100 U/mls.c.

K ullanımahazırsüspansiyoniçerenenjeksiyon kalemi

Cilt altına uygulanır.

Etkinmadde: İnsülin lispro.

Her1ml’de100 ünite(100 U/ml)insülin lispro içerir.HerbirHUMALOGMIX25KWIKPEN

300 ünite(3ml)içerir.

İnsülinlisprolaboratuvarortamında“rekombinantDNAteknolojisi”ileeldeedilmektedir.İnsan

insülininindeğiştirilmişbirformudurvebunedenlediğerhayvanveinsaninsülinlerinden

farklıdır.İnsülinlispropankreastarafındanyapılandoğalbirhormonolaninsaninsülinineçok

benzemektedir.

HUMALOGMIX25KWIKPENiçindeki%25 insülinlisprosudaçözünmüşhaldedir.

HUMALOG MIX25KWIKPENiçindeki%75insülinlisproiseprotaminsülfatlabirlikte

süspansiyonhaldedir.

Yardımcımaddeler:Protamin sülfat,metakrezol(1 ml’de1.76 mg),gliserol,fenol(1ml’de

0.80 mg),dibazik sodyumfosfat.7H

0,çinko oksit,enjeksiyonluk su,asit-bazdengesini

ayarlamak için hidroklorik asitvesodyumhidroksitkullanılabilir.

Builacıkullanmaya başlamadanöncebuKULLANMATALİMATINIdikkatlice

okuyunuz,çünkü sizin için önemlibilgileriçermektedir.

Kullanma talimatınısaklayınız. Daha sonra tekrarokumaya ihtiyaçduyabilirsiniz.

Eğerilavesorularınızolursa, lütfen doktorunuza veyaeczacınıza danışınız.

Bu ilaçkişiselolaraksizin için reçeteedilmiştir, başkalarına vermeyiniz.

Bu ilacın kullanımısırasında, doktora veya hastaneyegittiğinizdedoktorunuzabu ilacı

kullandığınızısöyleyiniz.

Bu talimatta yazılanlaraaynen uyunuz. İlaçhakkında sizeönerilen dozun dışındayüksek

veyadüşükdozkullanmayınız.

BuKullanma Talimatında:

1.HUMALOGMIX25KWIKPENnedirvene içink ullanılır?

2.HUMALOGMIX25KWIKPEN’ikullanmadanöncedikkatedilmesigerekenler

3.HUMALOGMIX25KWIKPENn asılkullanılır?

4. Olasıyanetkilernelerdir?

5.HUMALOGMIX25KWIKPEN’ins aklanması

Başlıklarıyeralmaktadır.

1/12

1.HUMALOGMIX25KWIKPENnedir veneiçink ullanılır?

HUMALOGMIX25KWIKPENbeyaz, sterilbirsüspansiyondur.

HUMALOGMIX25KWIKPENkutusunda3ml’lik 5 adetkullanımahazırkalembulunur.

KullanımahazırkalemleriniziçindekiHUMALOGMIX25kartuşilepiyasadaayrıolaraksatılan

HUMALOGMIX25 kartuşlaraynıdır.

Kalemsadecekartuşuiçindemuhafaza edenbiryapıdır.Kalemboşaldığındatekrar

kullanamazsınız.

HUMALOGMIX25KWIKPEN şekerhastalığını(diyabeti)tedavietmekiçinkullanılanhazırbir

süspansiyon karışımıdır.HUMALOGMIX25KWIKPENiçindeki%25insülin lisprosuda

çözün müşhaldedirvebuilaçtakiinsülin molekülükısmendeğiştirilmişolduğundannormalinsan

insülinindendahahızlıetkieder. HUMALOGMIX25KWIKPENiçindeki%75insülinlisproise

protamin sülfatlabirliktesüspansiyon haldeolduğundanetkisidahauzundur.

Eğerpankreasınızkanınızdakişekerdüzeyinizikontroledecek kadarinsülin üretmezseşeker

hastalığı(diyabet)oluşur.HUMALOGMIX25KWIKPENsizinkendiinsülininizinyerine geçer

veuzun dönemde kanşekerikontrolüiçinkullanılır.HUMALOGMIX25KWIKPENçokhızlı

etkigösterirveinsaninsülinine göreetkisidahauzundur.HUMALOGMIX25KWIKPEN’i

normalolarakyemektenönceki15 dakikaiçinde kullanmalısınız.

DoktorunuzsizeHUMALOGMIX25KWIKPENilebirlikteuzunetkilibirinsülin de

kullanmanızısöyleyebilir.

Herfarklıtürinsüliniçinayrıkullanmatalimatıbulunmaktadır.Doktorunuzsize söylemeden

insülininizideğiştirmeyiniz.İnsülininizideğiştirirsenizçok dikkatliolunuz.

2.HUMALOGMIX25KWIKPEN’ikullanmadanöncedikkatedilmesigerekenler

HUMALOGMIX25KWIKPEN’ia şağıdakidurumlardaKULLANMAYINIZ

Eğer;

K anşekerinizinçokdüştüğünü(hipoglisemi)hissediyorvedüşünüyorsanız.Bukullanma

talimatınınilerikibölümlerindehafifkanşekeridüşüklüğüilenasılbaşaçıkabileceğiniz

anlatılacaktır.(bkz. Bölüm3-KullanmanızgerekendendahafazlaHUMALOG

kullandıysanız)

İnsülin lisproyakarşıyadaHUMALOGMIX25KWIKPEN’iniçindekidiğeryardımcı

maddelerekarşıalerjiniz(aşırıduyarlılık)varsa

HUMALOGMIX25KWIKPEN’i aşağıdakidurumlarda DİKKATLİKULLANINIZ

Eğer;

Mevcutinsülin tedavinizil ekanşekeridüzeyiniziyikontrolediliyorsa,kanşekerinizçok

düştüğündeortayaçıkanuyarıbelirtilerinihissedemeyebilirsiniz.Buuyarıbelirtilerikullanma

talimatınızınilerleyenbölümlerindebelirtilmiştir.Yemeklerinizinezamanyemeniz

2/12

gerektiğini,nesıklıktavenekadaregzersizyapmanızgerektiğinidikkatledüşünmelisiniz.

Bununlabirliktekanşekerinizisıksıkölçerekkanşekerseviyeniziyakındantakip

etmelisiniz.

Hayvankaynaklıinsülinkullanımından insaninsülininegeçen vekanşekeridüşüklüğü

(hipoglisemi) yaşayanbirkaçkişidedahaazbelirginveyadahafarklışekildeerkenuyarı

belirtilerinin olduğugözlenmiştir.Eğersıkolarakkanşekeridüşüklüğüyaşıyorsanızveyakan

şekeridüşüklüğünühissetmektegüçlükçekiyorsanız, lütfen bunu doktorunuzlakonuşunuz.

Hipokalemi ( potasyumdüşüklüğü):Tedaviedilmeyenhipokalemisolunumfelci,ritim

bozukluğuveölümenedenolabilir.HUMALOGKWIKPENvediğerinsülinlerinetki

farklılığınedeniyleklinikolarakyanetkigörülmeriskiolanhastalarda(örneğinoruçtutan,

otonomik nöro patisi(sinirsistemihastalığı)olanveyapotasyumdüşürücüilaçlarkullananya

da serumpotasyumdüzeylerine hassasiyetgösterenilaç alanhastalar)dikkatedilmelidir.

Tüminsülinpreparatlarındaolduğugibi,HUMALOG’unetkisüresideğişikbireylerdeya da

aynıkişidedeğişikzamanlardaenjeksiyonbölgesi,kandesteği,sıcaklıkvefizikselaktiviteye

bağlıolarak farklılıklargösterebilir.

Hastafizikselaktivitesiniveyaherzamankiyemekplanınıdeğiştirdiğindehangiinsülin

olursaolsun dozayarla masıyapılmasıgerekebilir.Hastalık,duygusalrahatsızlıkveyastres

sırasındadainsülin gereksinimlerideğişebilir.

Hipoglisemi(kanşekeridüşüklüğü):Diğerinsülinpreparatlarındaolduğugibi,HUMALOG

KWIKPENuygulamasıylailişkilihipoglisemikreaksiyonlarolabilir. Serumglukoz

konsantrasyonlarındakihızlıdeğişimdiyabetlihastalardaglukozdeğerindenbağımsızolarak

hipoglisemisemptomlarınıuyarabilir.

Hipogliseminin erken uyarısemptomlarınıfarklılaştıran veyadahaazbelirgin halegetiren

urumlar;uzun sürelidiyabetöyküsü,yoğun insülin tedavisi, diyabetik nöropatiyadabeta

blokörlergibiilaçlardır.

LokalAlerji:Tüminsülintedavilerindeolduğugibi,hastalardaenjeksiyonbölgesinde

kızarıklık,şişkinlikveyakaşıntıolabilir.Buminörreaksiyonlarbirkaçgün ilebirkaçhaftada

düzelirfakatbazıdurumlardaHUMALOGtedavisininkesilmesigerekebilir.Bazen,bu

reaksiyonlarcilt temizlememalzemeleri içindeki iritanlarveyauygunolmayanenjeksiyon

tekniklerigibiinsülinden başkafaktörlerledeilişkiliolabilir.

SistemikAlerji:Ciddi,yaşamıtehditeden,HUMALOGdahilherhangibirinsülinlemeydana

gelengenelalerji.Genelalerjitümvücuttadöküntüye(kaşıntıdahil),nefesdarlığına,hırıltılı

solunuma,tansiyondüşmesi,hızlınabız,veyaterlemeyenedenolabilir.Anafilaktik

reaksiyonundahilolduğuciddisistemikalerjivakalarıhayatıtehditedebilir.Krezolün

enjeksiyonlukpreparatlardayardımcımaddeolarakkullanılmasısonuculokalizereaksiyonlar

veyaygın kasağrısıbildirilmiştir.

A şağıdakisorulardanherhangibirini‘EVET’şeklindecevaplıyorsanız,doktorunuzaveya

eczacınızadanışınız:

− Son zamanlardahastalandınızmı?

− Böbrek veyakaraciğerhastalığınızvarmı?

−Normaldenfazlafiziksel aktivitedebulunuyormusunuz?

Alkolal ırsanız,ihtiyacınızolan insülin miktarıdeğişebilir.

3/12

Y urtdışıseyahatineçıkmayıdüşünüyorsanızbunudadoktorveyaeczacınızabildirmelisiniz.

Ülkeler arasısaatfarkı,enjeksiyonlarınızıveöğünlerinizievdekindenfarklızamanlarda

uygulamanızıgerektirebilir.

UzunsüredirTip2diyabetiolanvekalphastalığıolanveyadahaönceinmegeçirmişolan,

pioglitazonveinsüliniletedaviedilenhastalardakalpyetmezliğindeartışgörülmüştür.

Alışılmışındışındanefesdarlığı,anikiloartışıveyaödemgibikalpyetmezliğibelirtileri

yaşarsanızenyakın zamandadoktorunuzu bilgilendiriniz.

Buuyarılargeçmiştekiherhangibirdönemdedahiolsasiziniçingeçerliyselütfendoktorunuza

danışınız.

HUMALOGMIX25KWIKPEN ’inyiyecekveiçecekilekullanılması

rmalşartlaraltında,HUMALOGMIX25KWIKPEN’iyemeklerdenönceki15 dakikaiçinde

enjekteetmelisiniz.Eğergerekirseyemektenhemensonradaenjekteedebilirsiniz.Doktorunuz

tamolarak nekadar, nezaman vehangisıklıktakullanmanızgerektiğinisizesöyleyecektir.

Hamilelik

İlacıkullanmadan öncedoktorunuza veyaeczacınıza danışınız.

Hamileliksırasındainsülintedavisigörenhastalardaşekerhastalığınınkontrolübüyükönem

taşır. Genellikle, insülin gereksinimindehamileliğin ilk 3 ayındaazalma,sonraki6 aylık dönemde

deartışgözlenir.Şekerhastalarına,HUMALOGMIX25kullanırkenhamilekaldıklarındayada

kalmayıdüşündüklerindedurumudoktorlarınabildirmeleritavsiyeedilmelidir.Şekerhastalarının

hamileliğisırasındaşekerdüzeylerivegenelsağlıkdurumlarıdikkatleizlenmelidir.

Tedavinizsırasındahamileolduğunuzufarkedersenizhemendoktorunuzaveyaeczacınıza

danışınız.

Emzirme

İlacıkullanmadan öncedoktorunuza veyaeczacınıza danışınız.

Emziren diyabetliannelerin insülin dozun da, beslenmetarzındayadaherikisindedeğişiklik

yapılmasıgerekebilir.

Araçvemakinekullanımı

Kanşekeridüşüklüğü(hipoglisemi)durumundayaptığınızişekonsantreolabilmevereaksiyon

göstermeyetilerinizazalabilir.Lütfenkendinizivebaşkalarınıriskaltınasokabilecekbütün

koşullarda(örneğintaşıtveyamakinekullanırken)buolasıproblemiaklınızdabulundurunuz.

Aşağıdakidurumlardataşıtkullanımıiçin doktorunuzun tavsiyesinebaşvurunuz.

Sık kan şekeridüşüklüğü(hipoglisemi)ataklarıgeçiriyorsanız

K an şekeridüşüklüğü (hipoglisemi)belirtilerinihissedemiyorsanız

4/12

HUMALOGMIX25KWIKPEN ’iniçeriğindebulunanbazıyardımcımaddelerhakkında

önemli bilgiler

HUMALOGMIX25KWIKPEN’inherbirmililitresindealerjikreaksiyonlaranedenolabilecek

metakrezolmaddesinden1.76mgbulunur.

Butıbbiürünherml’sinde1mmol(23mg)’danazsodyumihtivaeder;yaniesasında“sodyum

içermez”.

Diğerilaçlarilebirliktekullanımı

İnsülinihtiyacınızaşağıdakiilaçlarıaldığınızdadeğişebilir:

Doğumkontrolhapları(doğumkontrolünüsağlamakvegebeliğiengellemekamacıyla

kullanılan hormon ilaçları)

Steroidler(steroidiçerenilaçlar)

İzoniazid (veremtedavisindekullanılan ilaçlar), niasin (B3vitaminiiçeren ilaçlar)velipid

düşürücüilaçlar(kandayükseklipitseviyelerinintedavisindekullanılançeşitlitürde

ilaçlar)

Tiroidhormontedavisi(tiroidbezindemeydanagelenhastalıklardoğrultusunda

uygulanan tedavi)

Ağızdan alınan şekerilaçları(şekerhastalığıtedavisindekullanılan ilaçlar)

Asetil salisilikasit ( ağrıkesici,iltihabıazaltıcı,ateşdüşürücüvekansulandırıcıetkisi

olanilaçlar)

Sülfagrubuantibiyotikler(enfeksiyonasebep olan bakterilerekarşıkullanılan ilaçlar)

Oktreotid (büyümehormonu fazlalığındakullanılan ilaçlar)

“Beta

2 stimulanıilaçlar”(ritodrin,salbutamolveyaterbutalingibi)(solukalmayı

kolaylaştıranilaçlar)

Beta- blokörlerveyabazıantidepresanlar(monoaminoksidaz(MAO)inhibitörleri,selektif

serotonin gerialıminhibitörleri)(kalp hastalıklarıvebazısinirsistemiilaçları)

Ovülasyon üzerindeetkiliolan danazol( ürogenitalorganhastalıklarınıntedavisinde

kullanılanilaçlar)

KaptoprilveenalaprilgibibazıAnjiyotensin Dönüştürücü Enzim(ADE)inhibitörleri(kan

basıncınıdüzenleyiciilaçlar)

Anjiyot ensinIIreseptörblokörüantihipertansifilaçlar(yüksekkanbasıncıtedavisinde

kullanılanilaçlar)

Diüretikilaçlar (idrarsöktürücü),hipertansiyontedavisineyardımcıolmakamacıylaidrar

atılımınıkolaylaştıranvefazlalaştıranilaçlar

Eğerreçeteliyadareçetesizherhangibirilacışuandakullanıyorsanızveyasonzamanlarda

kullandınızsa lütfen doktorunuzaveya eczacınızabunlarhakkında bilgiveriniz.

3.HUMALOGMIX25KWIKPENn asılkullanılır?

İlacınızıeczanedenaldığınızdakutu vekullanımahazırkalemetiketiniinsülinismi vetipi

içinkontrolediniz.DoktorunuzunsizekullanmanızısöylediğiHUMALOGMIX25

KWIKPEN ’ialdığınızdanemin olunuz.

5/12

HUMALOGMIX25KWIKPEN’i herzamandoktorunuzunsizesöylediğişekildekullanınız.

Emin olmadığınızdurumdadoktorunuza sorarakkontrolediniz.

Olasıhastalıkbulaşmalarınıönlemekiçin,iğneucudeğişmişolsabileherbirkalemtekbirhasta

tarafındankullanılmalıdır.

Uygunkullanımvedoz/uygulama sıklığıiçintalimatlar:

Normalşartlaraltında,HUMALOGMIX25KWIKPEN’iyemeklerdenönceki15 dakikaiçinde

enjekteetmelisiniz. Eğergerekirseyemekten hemen sonradaenjekteedebilirsiniz.

Doktorunuztamolaraknekadar,nezamanvehangisıklıktakullanmanızgerektiğinisize

söyleyecektir.Sadece siziniçinolanbutalimatlaratam olarakuyunuzvedoktorunuzu düzenli

olarak ziyaretediniz.

Eğerkullandığınızinsülintipini(örneğinbirinsanveyahayvaninsülininden birHumalog

ürününe)değiştirirseniz,eskisindendahaazveyaçokmiktardaalmanızgerekebilir.Bu durum

sadeceilkenjeksiyoniçinuygulanabilirveyahaftalarveyaaylarcasürenkademelibirdeğişiklik

yapılabilir.

Uygulama yoluvemetodu:

HUMALOGMIX25KWIKPEN’isadececilt altınaenjekteediniz.Değişikuygulamayolları

kullanarak uygulamayınız.

HUMALOGMIX25KWIKPEN hiçbirkoşuldadamaryoluyla(intravenöz)enjekte

edilmemelidir.

HUMALOGMIX25KWIKPEN’in hazırlanması

Kullanmadan hemen önce kalemiiçerdiğiinsülinsüspansiyonubulanıkyadasütgibi bir

görünümalıncayakadar,ikielinizinarasındaonkezilerigeriyuvarlayınızveardındanyineon

kezbirelinizle180 o

yukarıaşağıçevirerekkarıştırınız.Bulanıkyadasütgibibirgörünüm

oluşmazsa,yukarıdabelirtilenişlemiiçerikkarışıncayakadartekrarediniz.Kartuşlarkarıştırmayı

kolaylaştırmakiçinküçükcamboncukiçerir.Dozuntamolarakölçülmesiniengelleyebilecek

köpürmelerenedenolabileceğinden,kartuşçokşiddetliçalkalanmamalıdır.Kartuşlarınsıksık

kontrol edilmesi veiçin detopaklarvarsayadabeyazparçacıklarkartuşundibiyadaduvarına

yapışarakdonukbirgörünümoluşturuyorsaHUMALOGMIX25KWIKPEN’inkullanılmaması

gerekir. Yapacağınızherenjeksiyondan öncekontrolediniz.

Kaleminkullanımahazırhalegetirilmesi(İlaçkutunuzuniçindeyeralanKalemKullanım

Kılavuzunu okuyunuz)

Öncelikleelleriniziyıkayınız.

Kullanımahazırkalemilebirliktesunulantalimatlarıokuyunuz.Talimatlarıdikkatle

uygulayınız. Aşağıdabazıhatırlatmalarverilmiştir.

Temizbiriğnekullanınız(İğnelerambalajiçindeyeralmamaktadır).

Herkullanımdanöncekaleminizienjeksiyoniçinhazırhalegetiriniz.Buiğnedeninsülin

çıkışınınkontrolünüvekalemdekihavakabarcıklarınınatılmasınısağlar.Yinedekalem

6/12

içerisindebazıküçükhavakabarcıklarıkalmışolabilirkibunlarzararsızdır.Ancakhava

kabarcıklarıçok büyükseinsülin dozunu etkileyebilir.

HUMALOGMIX25KWIKPEN’inenjekte edilmesi

Enjeksiyonyapmadan önce, en jeksiyonyapılacakbölgeyisizebelirtildiğişekildetemizleyiniz.

Sizeöğretildiğibiçimdeciltaltınaenjekteediniz.Doğrudandamariçineenjeksiyonyapmayınız.

Dozuntamamınıaldığınızdaneminolmakiçinenjeksiyonutamamladıktansonra,iğneyideri

altında5saniyekadartutunuz.Enjeksiyonyaptıktanhemensonraenjeksiyon bölgesini

uşturmayınız.Ensonuygulanannoktanınenaz1cmuzağınaveherseferinde,sizegösterildiği

gibienjeksiyonyapılan bölgelerisırailedeğiştirdiğinizden emin olunuz.

Enjeksiyon sonra

Enjeksiyonuyaparyapmaz,iğnedışkapağınınyardımıylaiğneyikaleminucundançıkarınız.Bu

işleminsülinisteriltutacakvesızıntıyıönleyecektir.Ayrıcahavanınkalemiçinetekrargirmesini

ve iğnenintıkanmasınıdaengelleyecektir.İğnelerinizibaşkalarıylapaylaşmayınız.Kaleminizi

başkalarıylapaylaşmayınız.Kaleminizin kapağınıkapalıtutunuz.

Daha sonrakienjeksiyonlar

Kalemleyapılanherenjeksiyondayenibiriğnekullanınız.Herenjeksiyondan öncehava

kabarcıklarınıyokediniz.Kalemiiğnesiyukarıgelecekşekildetutaraknekadarinsülinkaldığını

görebilirsiniz.Kartuşüzerindekiölçeksizeyaklaşıkkaçünitekaldığınıgösterir.Ölçekteki

aralıklardan herbiriyaklaşık 20 ünitedir.

Başkabirinsülinikalemiçinekarıştırmayınız.Kalemiboşaldıktansonrakullanmayınız.Biten

kalemi dikkatlibirşekildeatınız–eczacınızveyadiyabethemşirenizsizekaleminizinasıl

atmanızgerektiğinianlatacaktır.

Değişikyaşgrupları:

Çocuklardakullanımı:HUMALOGMIX25KWIKPENhemyetişkinlerdehemdeçocuklarda

kullanımiçinuygundur.HUMALOGMIX25KWIKPEN’in12yaşındanküçükçocuklarda

uygulanması,yalnızcabeklenenyararlarregülerinsülinden fazlaolduğundadüşünülmelidir.

Yaşlılardakullanımı:HUMALOGMIX25KWIKPENyaşlılardakullanımiçin uygundur.

Özelkullanımdurumları:

Böbrek/ka raciğeryetmezliği

Böbrek vekaraciğeryetmezliğidurumundainsülin gereksinimideğişebilir.

Böbrekvekaraciğerişlevbozukluğuolanhastalardaglukozdüzeylerininizlenmesiveinsülin

dozundaayarlamayapmak gerekebilir.

EğerHUMALOGMIX25KWIKPEN’inetkisininçokgüçlüveyazayıfolduğunadairbir

izleniminizvarisedoktorunuzveya eczacınızilekonuşunuz.

K ullanmanızgerekendendaha fazlaHUMALOGMIX25KWIKPENkullandıysanız:

7/12

HUMALOGMIX25KWIKPEN ’denkullanmanızgerekendenfazlasınıkullanmışsanızbirdoktor

veyaeczacıilekonuşunuz.

EğergerekendendahafazlaHUMALOGMIX25KWIKPENkullanırsanızkanşekeri

düzeyinizde düşüşgörülebilir.Kanşekerinizikontrolediniz.Eğerkanşekerinizdüşükse(hafif

hipoglisemi), şekeralınızyadaşekerlibiriçecekiçiniz.Dahasonradoktorunuzunönerdiğigibi

meyve, bisküviveyabirsandviçyiyinizvebirazdinleniniz. Genelliklebuyöntemhafifkan

şekeridüşüklüğü(hipoglisemi)veyaküçükbir insülindozaşımınıatlatmanızayardımcıolacaktır.

Eğerdurumunuzkötüleşirse,nefesalıpverişinizsıklaşırsavecildinizsoluklaşırsaderhal

doktorunuzabildiriniz.Ciddi kanşekeridüşüklüğü(hipoglisemi)glukagonenjeksiyonuiletedavi

edebilir. Glukagonenjeksiyonundansonra şekeryiyinyadaşekerlisıvıalın.Eğerglukagona

yanıtvermezseniz,hastaneyegitmenizgerekecektir.Glukagonhakkındabilgialmakiçin

doktorunuzadanışınız.

EğerHUMALOGMIX25KWIKPENkullanmayıunutursanız

EğeralmanızgerekendendahaazHUMALOGMIX25KWIKPENalırsanız,kanşekeriniz

yükselebilir . Kan şekerinizikontrolediniz.

Eğerkanşekerinindüşmesi(hipoglisemi)veyakanşekerinin yükselmesi(hiperglisemi)tedavi

edilmezseçokciddisonuçlarayolaçabilirvebaşağrısı,bulantı,kusma,susuzluk,şuurkaybı,

komahattaölümlesonuçlanabilir(Bkz. Bölüm4- Olasıyanetkiler).

Kanşekeridüşüklüğünü(hipoglisemi)veyakanşekeriyüksekliğini(hiperglisemi)önlemekiçin3

basitadım:

Kaleminizi nkaybolmasıveya hasargörmesiihtimallerinekarşıyanınızdaherzamanyedek

birşırıngailebirlikteyedekbirHUMALOGMIX25flakon veyayedekbiruygulamakalemi

ilebirlikteyedekbirHUMALOGMIX25 kartuşbulundurunuz.

Herzaman, şekerhastası(diyabetik)olduğunuzu gösteren biruyarıyıyanınızdataşıyınız.

Herzamanyanınızdaşekerbulundurunuz.

Unutulan dozlarıdengelemekiçin çiftdozalmayınız.

HUMALOGMIX25KWIKPEN iletedavisonlandırıldığındaoluşabileceketkiler

EğeralmanızgerekendendahaazHUMALOGMIX25KWIKPENalırsanız,kanşekerindebir

yükselmeortayaçıkabilir.Doktorunuzaksinisöylemediğitakdirdealdığınızinsülini

değiştirmeyiniz.

Eğerbuürününkullanımıhakkındailavesorularınızvarsa,doktorunuzaveyaeczacınıza

danışınız.

8/12

4. Olasıyanetkilernelerdir?

Tüm ilaçlargibi HUMALOGMIX25KWIKPEN ’iniçeriğindebulunanmaddelereduyarlıolan

kişilerdeyanetkilerolabilir.Ancak bu herkesteyan etkigörüldüğü anlamınagelmez.

Aşağıdakilerdenbiriolursa,HUMALOGMIX25KWIKPEN’ikullanmayıdurdurunuzve

DERHALdoktorunuzabildiriniz veya sizeenyakınhastaneninacilbölümünebaşvurunuz:

Kanşekerinindüşmesi(hipoglisemi)

Sistemikalerji

endiniaşağıdakibelirtilerilegösterir:

-Tümvücuttadöküntü

-Nefesalmada zorluk

- Hırıltılısolunum

- Kan basıncındadüşme

- Kalp atışındahızlanma

-Terleme

Bunlarınhepsiçokciddiyanetkilerdir.Eğerbunlardanbirisizdemevcutise,sizinHUMALOG

MIX25KWIKPEN’e karşıciddialerjinizvardemektir.Aciltıbbimüdahaleyeveyahastaneye

yatırılmanızagerekolabilir.

Bu çok ciddiyanetkilerin hepsioldukçaseyrekgörülür.

Sıklıklaraşağıdakişekildetanımlanır:

Çokyaygın(≥1/10);yaygın(≥1/100 ila<1/10);yaygınolmayan(≥1/1,000 ila<1/100);

seyrek( ≥1/10,000 ila<1/1,000);çok seyrek (<1/10,000), bilinmiyor(eldekiverilerden

hareketletahminedilemiyor).

Yaygın

Lokalalerji:Bazıinsanlarinsülinenjeksiyonuyapılanbölgedekızarıklık,şişmeveyakaşıntı

hissedebilir. Bu durumgenelliklebirkaçgün veyahaftaiçerisindedüzelir.

Yaygın olmayan

Enjeksiyonbölgesideğişiklikleri:Sıkenjeksiyonabağlıolarakobölgedeciltaltıdokusunun

kalınlaşmasıveyaçukurlaşması(lipodistrofi).Eğerenjeksiyonbölgesindederinizin

kalınlaştığınıveyaçukurlaştığınıfarkedersenizdoktorunuzabildiriniz.

Bilinmiyor

İnsülintedavisininbaşlangıcındaveyakanglukozunukontroletmekiçintedavideyapılan

değişimsırasındaödem(örneğin;kollarda, bileklerdeşişme, su tutulması)raporlanmıştır.

Eğerbukullanmatalimatındabahsigeçmeyenherhangibiryanetkiilekarşılaşırsanız

doktorunuzu veyaeczacınızıbilgilendiriniz.

9/12

Şekerhastalığındasıkgörülenproblemler

A- Kanşekeridüşüklüğü(Hipoglisemi)

an şekerinizin düşmesi(hipoglisemi)kanınızdayeterinceşekerolmadığıanlamınagelir.Bunun

sebebiaşağıdakilerolabilir;

HUMALOGMIX25KWIKPEN yadabaşkainsüliniçokfazlakullanıyorsanız

Ö ğünatlıyoryadageciktiriyorveyadiyetinizideğiştiriyorsanız

Bir öğünden hemen önceyadahemen sonraçokfazlafizikselaktivitedebulunuyoryadaiş

yapıyorsanız,

B irenfeksiyonyadahastalığınız(özellikleishalyadakusma)varsa,

İnsülin ihtiyacınızdabirdeğişiklikvarsayada

B öbrekyadakaraciğerinizdevarolan birsorun dahadakötüleşiyorsa.

Alkolvebazıilaçlarkandakişekerdüzeyinizietkileyebilir.

an şekerinizindüşmesininilkbelirtileri genellikleçabukbelliolurveaşağıdakileriiçerir:

Yorgunluk

Sinirlilikyadatitreme

Başağrısı

Kalp atışındahızlanma

Bulantı

Soğuk terleme

Uyarısemptomlarınıtanımaktahenüzçokeminolmadığınızda,kanşekeridüşüklüğünedeniyle

arabakullanmagibisiziveya başkalarınıriskesokabilecek durumlaraengelolunuz.

B- Kanşekeriyüksekliği(hiperglisemi)vediyabetikketoasidoz

Kan şekerininyükselmesi(hiperglisemi)vücudunuzdayeterinceinsülin olmadığıanlamına

gelir.

Kan şekerinizinyükselmesi (hiperglisemi)aşağıdakinedenlerdenolabilir:

HUMALOG MIX25KWIKPEN yadadiğerinsülininizialmamak

Doktorunuzunsize söylediğinden dahaazinsülin almak

Diyetinizin izin verdiğinden çok dahafazlasınıyemek

A teş, enfeksiyon veyaduygusalstres

Kanşekerininyükselmesi(hiperglisemi)şekerhastalığınınensıkrastlananveiyitedaviedilse

bilehayatıtehditedenakutkomplikasyonlarındanolandiyabetik ketoasidozaneden olabilir.Bu

rahatsızlıkta,vücuttakiinsülinseviyelerininyetersizoluşu,kanşekerinin(glukoz)yüksek

olmasınavekandaketonadıverilenmaddelerinbirikmesine(ketoasidoz)nedenolur.Diyabetik

ketoasidoz, tedav iğitakdirde, komayahattaölümenedenolabilir.

Diyabetikketoasidozgenelliklehastalıkveyabaşkabirsağlıksorunugibi,streslibirolayile

tetiklenir.Burahatsızlıkaynızamandainsülintedavisininyetersizolmasındandailerigelebilir.

10/12

Diyabetikketoasidozençoktip1diyabetibulunankişilerdeyaygındır,ancaktip2diyabeti

bulunankişilerdedegörülebilir.Diyabetikketoasidozkişinindiyabetinekoyduran ilk bulgusu

olabilir.

Belirtilersaatlervegünleriçerisindeortayaçıkabilirveaşağıdakileriiçerir:

Uykulu hissetmek

Yüzkızarması

Susuzluk

İştahsızlık

Nefesteaseton kokusu

Bulantıyadakusma

Ciddi belirtiler, sıkvederinnefesalıpvermevenabzınhızlanmasıdır.Böylebirdurumda

hementıbbiyardımalınız.

C- Hastalık

zellikleeğerhastahissediyorsanızya da hastaysanızihtiyaçduyduğunuzinsülinmiktarı

değişebilir.Normalolarakyemekyemediğinizdebileinsülineihtiyacınızvardır.İdraryada

kantesti yaptırınız, hastaiken uyguladığınızkurallarıuygulayınızvedoktorunuzabildiriniz.

Yan etkilerin raporlanması

KullanmaTalimatındayeralanveyaalmayanherhangibiryanetkimeydanagelmesidurumunda

hekiminiz, eczacınızveyahemşirenizilekonuşunuz.Ayrıcakarşılaştığınızyanetkileri

www.titck.gov.trsitesindeyeralan“İlaçYanEtkiBildirimi”ikonunatıklayarakyada080031400

08numaralıyanetkibildirimhattınıarayarakTürkiyeFarmakovijilansMerkezi(TÜFAM)’ne

bildiriniz.Meydanagelenyanetkileribildirerekkullanmaktaolduğunuzilacıngüvenliliğihakkında

dahafazlabilgiedinilmesinekatkısağlamışolacaksınız.

5.HUMALOGMIX25KWIKPEN’ins aklanması

HUMALOGMIX25KWIKPEN ’içocuklarıngöremeyeceği,erişemeyeceğiyerlerdeve

ambalajında saklayınız.

İlkkullanımakadarHUMALOGMIX25KWIKPEN’i(2°C–8°C)arasındabuzdolabında

saklayınız.Dondurmayınız.Donmuşürünleriçözüpkullanmayınız.Kullanmayabaşladığınız

HUMALOGMIX25KWIKPEN’i odasıcaklığında(30°C’ninaltında)28günekadar

saklayabilirsiniz. Kullandığınızkullanımahazırkaleminizibuzdolabındasaklamayınız.Aşırı

sıcak vedirektgüneşışığıaltındabırakmayınız.Kaleminiziiğnetakılıolaraksaklamayınız.

Sonkullanma tarihiyleuyumluolara kkullanınız.

AmbalajdakivekartuşetiketindekisonkullanmatarihindensonraHUMALOGMIX25

KWIKPEN ’ikullanmayınız.

Kartuşlarınsıksıkkontroledilmesiveiçindetopaklarvarsayadabeyazparçacıklarkartuşundibi

yadaduvarınayapışarakdonukbirgörünümoluşturuyorsaHUMALOGMIX25KWIKPEN’in

kullanılmamasıgerekir.Yapacağınızherenjeksiyondan öncekontrolediniz.

11/12

Eğerüründeve/veyaambalajındabozuklukfarkedersenizHUMALOGMIX25KWIKPEN’i

kullanmayınız.

ÇevreyikorumakamacıylakullanmadığınızHUMALOGMIX25KWIKPEN’işehirsuyunaveya

çöpeatmayınız. Bu konuda eczacınıza danışınız.

RuhsatSahibi:

LillyİlaçTicaretLtdŞti

AcıbademMah. Çeçen Sokak

AkasyaAcıbademKentEtabı

ABlok Kat:3

34660 Üsküdar/İstanbulTel:0 216 554 00 00

Faks:0 216 474 71 99

ÜretimYeri:

LillyFranceS.A.S.

RuedeColonelLilly,

67604Fegersheim, Fransa

Bu kullanma talimatı../../....tarihindeonaylanmıştır.

12/12

21-6-2018

FDA approves automated insulin delivery and monitoring system for use in younger pediatric patients

FDA approves automated insulin delivery and monitoring system for use in younger pediatric patients

FDA approves automated insulin delivery and monitoring system for use in younger pediatric patients

FDA - U.S. Food and Drug Administration

22-10-2018

EU/3/15/1532 (Sirius Regulatory Consulting EU Limited)

EU/3/15/1532 (Sirius Regulatory Consulting EU Limited)

EU/3/15/1532 (Active substance: Insulin human) - Transfer of orphan designation - Commission Decision (2018)6985 of Mon, 22 Oct 2018

Europe -DG Health and Food Safety

27-9-2018

We want to help patients/caregivers know how to use pen needles correctly. FDA received reports of patients using standard pen needles to inject insulin w/o removing the inner needle cover. The cover stopped patients from getting the right amnt of insulin

We want to help patients/caregivers know how to use pen needles correctly. FDA received reports of patients using standard pen needles to inject insulin w/o removing the inner needle cover. The cover stopped patients from getting the right amnt of insulin

We want to help patients/caregivers know how to use pen needles correctly. FDA received reports of patients using standard pen needles to inject insulin w/o removing the inner needle cover. The cover stopped patients from getting the right amnt of insulin https://go.usa.gov/xPWZq  pic.twitter.com/LT9SptJge1

FDA - U.S. Food and Drug Administration

24-9-2018

Ryzodeg (Novo Nordisk A/S)

Ryzodeg (Novo Nordisk A/S)

Ryzodeg (Active substance: Insulin degludec/insulin aspart) - Centralised - Yearly update - Commission Decision (2018)6242 of Mon, 24 Sep 2018

Europe -DG Health and Food Safety

24-9-2018

Tresiba (Novo Nordisk A/S)

Tresiba (Novo Nordisk A/S)

Tresiba (Active substance: Insulin degludec) - Centralised - Yearly update - Commission Decision (2018)6244 of Mon, 24 Sep 2018

Europe -DG Health and Food Safety

28-8-2018

EU/3/18/2061 (Pharma Gateway AB)

EU/3/18/2061 (Pharma Gateway AB)

EU/3/18/2061 (Active substance: Autologous glioma tumour cells treated with antisense molecule directed against the insulin-like growth factor type 1 receptor) - Orphan designation - Commission Decision (2018)5739 of Tue, 28 Aug 2018 European Medicines Agency (EMA) procedure number: EMA/OD/049/18

Europe -DG Health and Food Safety

6-8-2018

Insulin lispro Sanofi (Sanofi-Aventis groupe)

Insulin lispro Sanofi (Sanofi-Aventis groupe)

Insulin lispro Sanofi (Active substance: insulin lispro) - Centralised - Yearly update - Commission Decision (2018)5375 of Mon, 06 Aug 2018

Europe -DG Health and Food Safety

22-6-2018

FDA expands approval of hybrid closed loop system for monitoring and delivering insulin to pediatric patients as young as 7. #cgm #diabetes #pediatrics #fdaapproval #medicaldevice  http://go.usa.gov/xUqgQ pic.twitter.com/wZdrU6tTzf

FDA expands approval of hybrid closed loop system for monitoring and delivering insulin to pediatric patients as young as 7. #cgm #diabetes #pediatrics #fdaapproval #medicaldevice http://go.usa.gov/xUqgQ pic.twitter.com/wZdrU6tTzf

FDA expands approval of hybrid closed loop system for monitoring and delivering insulin to pediatric patients as young as 7. #cgm #diabetes #pediatrics #fdaapproval #medicaldevice http://go.usa.gov/xUqgQ  pic.twitter.com/wZdrU6tTzf

FDA - U.S. Food and Drug Administration

19-6-2018

Insuman (Sanofi-Aventis Deutschland GmbH)

Insuman (Sanofi-Aventis Deutschland GmbH)

Insuman (Active substance: human insulin) - Centralised - Yearly update - Commission Decision (2018)3889 of Tue, 19 Jun 2018

Europe -DG Health and Food Safety

19-6-2018

Lusduna (Merck Sharp and Dohme B.V.)

Lusduna (Merck Sharp and Dohme B.V.)

Lusduna (Active substance: insulin glargine) - Centralised - Transfer Marketing Authorisation Holder - Commission Decision (2018)3918 of Tue, 19 Jun 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/4101/T/6

Europe -DG Health and Food Safety

11-6-2018

Xultophy (Novo Nordisk A/S)

Xultophy (Novo Nordisk A/S)

Xultophy (Active substance: insulin degludec / liraglutide) - Centralised - 2-Monthly update - Commission Decision (2018)3779 of Mon, 11 Jun 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/2647/II/23

Europe -DG Health and Food Safety