HUMALOG

Genel Bilgiler

  • Ticaret Unvanı:
  • HUMALOG MIX 50 100IU/ML SUSPANSIYON ICEREN KARTUS(3 ML/5 KARTUS)
  • Reçete türü:
  • Normal
  • İçin kullanmak:
  • İnsanlar
  • İlaç türü:
  • allopatik ilaç

Belgeler

Yerelleştirme

  • Bulunduğu ülkeler::
  • HUMALOG MIX 50 100IU/ML SUSPANSIYON ICEREN KARTUS(3 ML/5 KARTUS)
    Türkiye
  • Dil:
  • Türkçe

Terapötik bilgiler

  • Terapötik alanı:
  • kombinasyonları

Diğer bilgiler

Durum

  • Kaynak:
  • TİTCK - TÜRKİYE İLAÇ VE TIBBİ CİHAZ KURUMU - Türkiye
  • Yetkilendirme durumu:
  • Aktif
  • Yetkilendirme numarası:
  • 8699673954202
  • Yetkilendirme tarihi:
  • 29-01-2013
  • Son Güncelleme:
  • 24-05-2018

Hasta Bilgi broşürü: Ürün Özellikleri Özeti - kompozisyon, endikasyonlar, yan etkiler, dozaj, etkileşimleri, advers reaksiyonlar, gebelik, laktasyon

KULLANMATALİMATI

HUMALOGMIX50

100IU/ml3ml kartuş

Cilt altına uygulanır.

Etkinmadde: İnsülin lispro.

Her1ml’de 100ünite(100IU/ml)insülinlisproiçerir.HerbirHUMALOGMIX50300 ünite(3

ml)içerir.

İnsülinlisprolaboratuvarortamında“rekombinantDNAteknolojisi”ileeldeedilmektedir.İnsan

insülininindeğiştirilmişbirformudurvebunedenlediğerhayvanveinsaninsülinlerinden

farklıdır.İnsülinlispropankreastarafındanyapılandoğalbirhormonolaninsaninsülinineçok

benzemektedir.

HUMALOGMIX50içindeki%50 insülinlisprosudaçözünmüşhaldedir.HUMALOGMIX50

içindeki%50insülinlisproiseprotamin sülfatlabirliktesüspansiyonhaldedir.

Yardımcımaddeler:Protaminsülfat,metakrezol(1 ml’de2.2mg),gliserol,fenol(1ml’de1

mg),dibazik sodyumfosfat.7H

0,çinko oksit,enjeksiyonluk su,asit-bazdengesiniayarlamak

için hidroklorik asitvesodyumhidroksitkullanılabilir.

Builacıkullanmaya başlamadanöncebuKULLANMATALİMATINIdikkatlice

okuyunuz,çünkü sizin için önemli bilgileriçermektedir.

Kullanma talimatınısaklayınız. Daha sonra tekrarokumaya ihtiyaçduyabilirsiniz.

Eğerilavesorularınızolursa, lütfen doktorunuza veyaeczacınıza danışınız.

Bu ilaçkişiselolaraksizin için reçeteedilmiştir, başkalarına vermeyiniz.

Bu ilacın kullanımısırasında, doktora veya hastaneyegittiğinizdedoktorunuzabu ilacı

kullandığınızısöyleyiniz.

Bu talimatta yazılanlaraaynen uyunuz. İlaçhakkında sizeönerilen dozun dışındayüksek

veyadüşükdozkullanmayınız.

BuKullanma Tal imatında:

1.HUMALOGMIX50nedirvene içink ullanılır?

2.HUMALOGMIX50’yikullanmadanöncedikkatedilmesigerekenler

3.HUMALOGMIX50n asılkullanılır?

4. Olasıyanetkilernelerdir?

5.HUMALOGMIX50’nins aklanması

Başlıklarıyeralmaktadır.

1.HUMALOGMIX50nedir veneiçink ullanılır?

HUMALOGMIX50beyaz, sterilbirsüspansiyondur.

HUMALOGMIX50kutusunda3ml’lik5adetk artuşbulunur.

1/11

HUMALOGMIX50 şekerhastalığını(diyabeti)tedavietmekiçinkullanılanhazırbir

süspansiyon karışımıdır.HUMALOGMIX50içindeki%50insülinlisprosudaçözünmüş

haldedirvebuilaçtakiinsülin molekülü kısmendeğiştirilmişolduğundannormalinsan

insülinindendahahızlıetkieder.HUMALOGMIX50içindeki%50insülinlisproiseprotamin

sülfatlabirliktesüspansiyon haldeolduğundanetkisidahauzundur.

Eğerpankreasınızkanınızdakişekerdüzeyinizikontroledecek kadarinsülin üretmezseşeker

hastalığı(diyabet)oluşur.HUMALOGMIX50sizin kendiinsülininizinyerine geçerveuzun

dönemde kanşekerikontrolüiçinkullanılır.HUMALOGMIX50çokhızlıetkigösterirveinsan

insülinine göre etkisidahauzundur.HUMALOGMIX50’yinormalolarakyemekten önceki15

dakikaiçinde kullanmalısınız.

DoktorunuzsizeHUMALOGMIX50ilebirlikteuzunetkilibir insülindekullanmanızı

söyleyebilir. Herfarklıtürinsüliniçinayrıkullanmatalimatıbulunmaktadır.Doktorunuzsize

söylemedeninsülininizideğiştirmeyiniz.İnsülininizideğiştirirsenizçok dikkatliolunuz.

2.HUMALOGMIX50’yikullanmadanöncedikkatedilmesigerekenler

HUMALOGMIX50’yi a şağıdakidurumlardaKULLANMAYINIZ

Eğer;

K anşekerinizinçokdüştüğünü(hipoglisemi)hissediyorvedüşünüyorsanız.Bukullanma

talimatınınilerikibölümlerindehafifkanşekeridüşüklüğüilenasılbaşaçıkabileceğiniz

anlatılacaktır.

(bkz.Bölüm3-Kulla nmanızgerekendendahafazlaHUMALOG

kullandıysanız)

İnsülinlisproyakarşıyadaHUMALOGMIX50’niniçindekidiğeryardımcımaddelerekarşı

alerjiniz( aşırıduyarlılık) varsa

HUMALOGMIX50’yi aşağıdakidurumlarda DİKKATLİKULLANINIZ

Eğer;

Mevcutinsülin tedavinizil ekanşekeridüzeyiniziyikontrolediliyorsa,kanşekerinizçok

düştüğündeortayaçıkanuyarıbelirtilerinihissedemeyebilirsiniz.Buuyarıbelirtilerikullanma

talimatınızınilerleyenbölümlerindebelirtilmiştir.Yemeklerinizinezamanyemeniz

gerektiğini,nesıklıktavenekadaregzersizyapmanızgerektiğinidikkatledüşünmelisiniz.

Bununlabirliktekanşekerinizisıksıkölçerekkanşekerseviyeniziyakındantakip

etmelisiniz.

Hayvankaynaklıinsülinkullanımından insaninsülininegeçen vekanşekeridüşüklüğü

(hipoglisemi) yaşayanbirkaçkişidedahaazbelirginveyadahafarklışekildeerkenuyarı

belirtilerinin olduğugözlenmiştir.Eğersıkolarakkanşekeridüşüklüğüyaşıyorsanızveyakan

şekeridüşüklüğünühissetmektegüçlükçekiyorsanız,lütfen bunu doktorunuzlakonuşunuz.

Hipokalemi(potasyumdüşüklüğü):Tedaviedilmeyenhipokalemisolunumfelci,ritim

bozukluğuveölümenedenolabilir.HUMALOGKWIKPENvediğerinsülinlerinetki

farklılığınedeniyleklinikolarakyanetkigörülmeriskiolanhastalarda(örneğinoruçtutan,

otonomiknöropatisi(sinirsistemihastalığı)olanveyapotasyumdüşürücüilaçlarkullananya

da serumpotasyumdüzeylerine hassasiyetgösterenilaç alanhastalar)dikkatedilmelidir.

2/11

Tüminsülinpreparatlarındaolduğugibi,HUMALOG’unetkisüresideğişikbireylerdeyada

aynıkişidedeğişikzamanlardaenjeksiyonbölgesi,kandesteği,sıcaklıkvefizikselaktiviteye

bağlıolarak farklılıklargösterebilir.

Hastafizikselaktivitesiniveyaherzamankiyemekplanınıdeğiştirdiğindehangiinsülin

olursaolsundozayarlamasıyapılmasıgerekebilir.Hastalık,duygusalrahatsızlıkveyastres

sırasındadainsülin gereksinimlerideğişebilir.

Hipoglisemi(kanşekeridüşüklüğü):Diğerinsülinpreparatlarındaolduğugibi,HUMALOG

WIKPENuygulamasıylailişkilihipoglisemikreaksiyonlarolabilir.Serumglukoz

konsantrasyonlarındakihızlıdeğişimdiyabetlihastalardaglukozdeğerindenbağımsızolarak

hipoglisemisemptomlarınıuyarabilir.

Hipogliseminin erken uyarısemptomlarınıfarklılaştıran veyadahaazbelirgin halegetiren

durumlar;uzun sürelidiyabetöyküsü,yoğun insülin tedavisi, diyabetik nöropatiyadabeta

blokörlergibiilaçlardır.

LokalAlerji:Tüminsülintedavilerindeolduğugibi,hastalardaenjeksiyonbölgesinde

kızarıklık,şişkinlikveyakaşıntıolabilir.Buminörreaksiyonlarbirkaçgünilebirkaçhaftada

düzelirfakatbazıdurumlardaHUMALOGtedavisininkesilmesigerekebilir.Bazen,bu

reaksiyonlarcilt temizlememalzemeleri içindeki iritanlarveyauygunolmayanenjeksiyon

tekniklerigibiinsülinden başkafaktörlerledeilişkiliolabilir.

SistemikAlerji:Ciddi,yaşamıtehditeden,HUMALOGdahilherhangibirinsülinlemeydana

gelengenelalerji.Genelalerjitümvücuttadöküntüye(kaşıntıdahil),nefesdarlığına,hırıltılı

solunuma,tansiyondüşmesi,hızlınabız,veyaterlemeyenedenolabilir.Anafilaktik

reaksiyonundahilolduğuciddisistemikalerjivakalarıhayatıtehditedebilir.Krezolün

enjeksiyonlukpreparatlardayardımcımaddeolarakkullanılmasısonuculokalize reaksiyonlar

veyaygınkasağrısıbildirilmiştir.

A şağıdakisorulardanherhangibirini‘EVET’şeklindecevaplıyorsanız,doktorunuzaveya

eczacınızadanışınız:

− Son zamanlardahastalandınızmı?

− Böbrek veyakaraciğerhastalığınızvarmı?

−Normaldenfazlafiziksel aktivitedebulunuyormusunuz?

A lkolalırsanız,ihtiyacınızolan insülin miktarıdeğişebilir.

Y urtdışıseyahatineçıkmayıdüşünüyorsanızbunudadoktorveyaeczacınızabildirmelisiniz.

Ülkeler arasısaatfarkı,enjeksiyonlarınızıveöğünlerinizievdekindenfarklızamanlarda

uygulamanızıgerektirebilir.

UzunsüredirTip2diyabetiolanvekalphastalığıolanveyadahaönceinmegeçirmişolan,

pioglitazonveinsüliniletedaviedilenhastalardakalpyetmezliğindeartışgörülmüştür.

Alışılmışındışındanefesdarlığı,anikiloartışıveyaödemgibikalpyetmezliğibelirtileri

yaşarsanızenyakın zamandadoktorunuzu bilgilendiriniz.

Buuyarılargeçmiştekiherhangibirdönemdedahiolsasiziniçingeçerliyselütfendoktorunuza

danışınız.

HUMALOGMIX50’ni nyiyecekveiçecekilekullanılması

Normalşartlaraltında,HUMALOGMIX50’yiyemeklerdenönceki15dakikaiçindeenjekte

etmelisiniz.Eğergerekirseyemektenhemensonradaenjekteedebilirsiniz.Doktorunuztam

olarak nekadar, nezaman vehangisıklıktakullanmanızgerektiğinisizesöyleyecektir.

3/11

Hamilelik

İlacıkullanmadan öncedoktorunuza veyaeczacınıza danışınız.

Hamileliksırasındainsülintedavisigörenhastalardaşekerhastalığınınkontrolübüyükönem

taşır. Genellikle, insülin gereksinimindehamileliğin ilk 3 ayındaazalma, sonraki6 aylık dönemde

deartışgözlenir.Şekerhastalarına,HUMALOGMIX25kullanırkenhamilekaldıklarındayada

kalmayıdüşündüklerindedurumudoktorlarınabildirmeleritavsiyeedilmelidir.Şekerhastalarının

hamileliğisırasındaşekerdüzeylerivegenelsağlıkdurumlarıdikkatleizlenmelidir.

Tedavinizsırasındahamileolduğunuzufarkedersenizhemendoktorunuzaveyaeczacınıza

danışınız.

Emzirme

İlacıkullanmadan öncedoktorunuza veyaeczacınıza danışınız.

Emziren di yabetliannelerin insülin dozunda, beslenmetarzındayadaherikisindedeğişiklik

yapılmasıgerekebilir.

Araçvemakinekullanımı

Kanşekeridüşüklüğü(hipoglisemi)durumundayaptığınızişekonsantreolabilmevereaksiyon

göstermeyetilerinizazalabilir .Lütfenkendinizivebaşkalarınıriskaltınasokabilecekbütün

koşullarda(örneğintaşıtveyamakinekullanırken)buolasıproblemiaklınızdabulundurunuz.

Aşağıdakidurumlardataşıtkullanımıiçin doktorunuzun tavsiyesinebaşvurunuz.:

Sık kan şekeridüşüklüğü(hipoglisemi)ataklarıgeçiriyorsanız

Kan şekeridüşüklüğü (hipoglisemi)belirtilerinihissedemiyorsanız

HUMALOGMIX50’n iniçeriğindebulunanbazıyardımcımaddelerhakkındaönemli

bilgiler

HUMALOGMIX50’ninherbirmililitresindealerjikreaksiyonlara nedenolabilecekmetakrezol

maddesinden2.2mgbulunur.

Butıbbiürünherml’sinde1mmol(23mg)’danazsodyumihtivaeder;yaniesasında“sodyum

içermez”.

Diğerilaçlarilebirliktekullanımı

İnsülin ihtiyacınızaşağıdakiilaçlarıaldığınızdadeğişebilir:

Doğumkontrolhapları(doğumkontrolünüsağlamakvegebeliğiengellemekamacıyla

kullanılan hormon ilaçları)

Steroidler(steroidiçerenilaçlar)

İzoniazid (veremtedavisindekullanılan ilaçlar), niasin (B3vitaminiiçeren ilaçlar)velipid

düşürücüilaçlar(kandayükseklipitseviyelerinintedavisindekullanılançeşitlitürde

ilaçlar)

Tiroidhormontedavisi(tiroidbezindemeydanagelenhastalıklardoğrultusunda

uygulanan tedavi)

Ağızdan alınan şekerilaçları(şekerhastalığıtedavisindekullanılanilaçlar)

Asetil salisilikasit ( ağrıkesici,iltihabıazaltıcı,ateşdüşürücüvekansulandırıcıetkisi

olanilaçlar)

4/11

Sülfagrubuantibiyotikler(enfeksiyonasebep olan bakterilerekarşıkullanılan ilaçlar)

Oktreotid (büyümehormonu fazlalığındakullanılanilaçlar)

“Beta

2 stimulanıilaçlar”(ritodrin,salbutamolveyaterbutalingibi)(solukalmayı

kolaylaştıranilaçlar)

Beta- blokörlerveyabazıantidepresanlar(monoaminoksidaz(MAO)inhibitörleri,selektif

serotonin gerialıminhibitörleri)(kalp hastalıklarıvebazısinirsistemiilaçları)

Ovülasyon üzerindeetkiliolan danazol( ürogenitalorganhastalıklarınıntedavisinde

kullanılanilaçlar)

KaptoprilveenalaprilgibibazıAnjiyotensin Dönüştürücü Enzim(ADE)inhibitörleri(kan

basıncınıdüzenleyiciilaçlar)

AnjiyotensinIIreseptörblokörüantihipertansifilaçlar(yüksekkanbasıncıtedavisinde

kullanılanilaçlar)

Diüretikilaçlar (idrarsöktürücü),hipertansiyontedavisineyardımcıolmakamacıylaidrar

atılımınıkolaylaştıranvefazlalaştıranilaçlar

Eğerreçeteliyadareçetesizherhangibirilacışuandakullanıyorsanızveyasonzamanlarda

kullandınızsa lütfen doktorunuzaveya eczacınızabunlarhakkında bilgiveriniz.

3.HUMALOGMIX50n asılkullanılır?

3 ml’likkartuşsadece3ml’likkalemlerilekullanımiçindir.

İlacınızıeczanedenaldığınızdakutuvekartuşetiketiniinsülinismivetipiiçinkontrol

ediniz.DoktorunuzunsizekullanmanızısöylediğiHUMALOGMIX50’yialdığınızdanemin

olunuz.

HUMALOGMIX50’yiherzaman doktorunuzun sizesöyled iğişekildekullanınız.Emin

olmadığınızdurumdadoktorunuza sorarakkontrolediniz.

Olasıhastalıkbulaşmalarınıönlemekiçin,iğneucudeğişmişolsabileherbirkartuştekbirhasta

tarafındankullanılmalıdır.

Uygunkullanımvedoz/uygulama sıklığıiçintalimatlar:

Normalşartlaraltında,HUMALOGMIX50’yiyemeklerdenönceki15dakikaiçindeenjekte

etmelisiniz. Eğergerekirseyemekten hemen sonradaenjekteedebilirsiniz.

Doktorunuztamolaraknekadar,nezamanvehangisıklıktakullanmanızgerektiğinisize

söyleyecektir.Sadecesiziniçinolanbutalimatlaratam olarakuyunuzvedoktorunuzu düzenli

olarak ziyaretediniz.

Eğerkullandığınızinsülintipini(örneğinbirinsanveyahayvaninsülininden birHumalog

ürününe)değiştirirseniz,eskisindendahaazveyaçokmiktardaalmanızgerekebilir.Budurum

sadeceilkenjeksiyoniçinuygulanabilirveyahaftalarveyaaylarcasürenkademelibirdeğişiklik

yapılabilir.

5/11

Uygulama yoluvemetodu:

HUMALOGMIX50’yisadececilt altınaenjekteediniz.Değişikuygulamayollarıkullanarak

uygulamayınız.

HUMALOGMIX50 hiçbirkoşuldadamaryoluyla(intravenöz)enjekteedilmemelidir.

HUMALOGMIX50’nin hazırlanması

HUMALOGMIX50 içerenkartuşu,içerdiğiinsülinsüspansiyonubulanıkyadasütgibibir

görünümalıncayakadar,ikielinizinarasındaonkezilerigeriyuvarlayınveardındanyineonkez

birelinizle180 o

yukarıaşağıçevirerekkarıştırın.Bulanıkyadasütgibibirgörünümoluşmazsa,

yukarıdabelirtilenişlemiiçerikkarışıncayakadartekraredin.Kartuşlarkarıştırmayı

kolaylaştırmakiçinküçükcamboncukiçerir.Dozuntamolarakölçülmesiniengelleyebilecek

köpürmelerenedenolabileceğinden,kartuşçokşiddetliçalkalanmamalıdır.Kartuşlarınsıksık

troledilmesiveiçindetopaklarvarsayadabeyazparçacıklarkartuşundibiyadaduvarına

yapışarakdonukbirgörünümoluşturuyorsaHUMALOGMIX50’ninkullanılmamasıgerekir.

Yapacağınızherenjeksiyondan öncekontrolediniz.

Kalemin kullanımahazırhale getirilmesi(İlaçkutunuzuniçindeyeralanKalemKullanım

Kılavuzunu okuyunuz)

Öncelikleelleriniziyıkayınız.Kartuşun kauçuk contasınıdezenfekteediniz.

HUMALOGMIX50 kartuşlarıyalnızcauygunCEişaretlikalemlerilekullanmalısınız.

Lütfen kalemilebirliktesunulantalimattaHumalog yadaLillykartuşlarının

belirtilmişolduğundaneminolunuz.3ml’likkartuşsadece3ml’likkalemiçin

uygundur.

K alemilebirliktesunulan talimatlarıokuyunuz.Kartuşukalemiçineyerleştiriniz.

Temizbiriğnekullanınız. (İğnelerambalajiçindeyeralmamaktadır).

Dozu 1yada2üniteyeayarlayınız. Dahasonrakalemiyukarıgelecek şekildetutunuzveolası

havakabarcıklarınınyukarıçıkmasıiçinkaleminyantarafınahafifçevurunuz.İğneninucu

halenyukarıbakacakşekildetutarkenenjeksiyondüğmesinebasınız.Buişlemeiğnedenbir

damlaHUMALOGMIX50gelinceyekadardevamediniz. Kalemdehalen küçükhava

kabarcıklarıkalmışolabilirkibunlarzararsızdır.Ancak,havakabarcıklarıçokbüyükse

insülin dozunuzu etkileyebilir.

HUMALOGMIX50’ninenjekte edilmesi

Enjeksiyonyapmadan önce, en jeksiyonyapılacakbölgeyisizebelirtildiğişekildetemizleyiniz.

Sizeöğretildiğibiçimdeciltaltınaenjekteediniz.Doğrudandamariçineenjeksiyonyapmayınız.

Dozuntamamınıaldığınızdaneminolmakiçinenjeksiyonutamamladıktansonra,iğneyideri

altında5saniyekadartutunuz.Enjeksiyonyaptıktanhemensonraenjeksiyonbölgesini

uşturmayınız.Ensonuygulanannoktanınenaz1cmuzağınaveherseferinde,sizegösterildiği

ibienjeksiyonyapılan bölgelerisırailedeğiştirdiğinizden emin olunuz.

Enjeksiyon sonra

Enjeksiyonuyaparyapmaz, iğnedışkapağınınyardımıylaiğneyikaleminucundançıkarınız. Bu

işleminsülinisteriltutacak vesızıntıyıönleyecektir. Ayrıcahavanın kalemiçinetekrargirmesini

ve iğnenintıkanmasınıdaengelleyecektir.İğnelerinizibaşkalarıylapaylaşmayınız.Kaleminizi

başkalarıylapaylaşmayınız.Kaleminizin kapağınıkapalıtutunuz.Kartuşu kalemin içinde

bırakınız.

6/11

Daha sonrakienjeksiyonlar

Herenjeksiyondan önce,1 veya2 üniteçevirinizvekalemi iğnesiyukarıgelecekşekildetutarak

iğneninucundanbirdamlaHUMALOGMIX50çıkanakadarenjeksiyondüğmesinebasınız.

KartuşüzerindekiölçeksizeyaklaşıkkaçüniteHUMALOGMIX50kaldığınıgösterir.Ölçekteki

aralıklardanherbiriyaklaşık20 ünitedir.Eğerdozunuziçinyeterlimiktarkalmadıysakartuşu

değiştiriniz.

Herhangi birHUMALOGMIX50 kartuşuniçinebaşkabirinsülinkarıştırmayınız.Kartuş

boşalmışsa, tekrarkullanmayınız.

Değişikyaşgrupları:

Çocuklardakullanımı:HUMALOGMIX50hemyetişkinlerdehemdeçocuklardakullanımiçin

uygundur. HUMALOGMIX50’n in12yaşındanküçükçocuklardauygulanması,yalnızca

beklenenyararlarregülerinsülinden fazlaolduğundadüşünülmelidir.

Yaşlılarda kullanımı:HUMALOGMIX50yaşlılardakullanımiçin uygundur.

Özelkullanımdurumları:

Böbrek /karaciğeryetmezliği

Böbrek vekaraciğeryetmezliğidurumundainsülin gereksinimideğişebilir.

Böbrekvekaraciğerişlevbozukluğuolanhastalardaglukozdüzeylerininizlenmesi veinsülin

dozundaayarlamayapmak gerekebilir.

EğerHUMALOGMIX50’ninetkisininçokgüçlüveyazayıfolduğunadairbirizleniminizvarise

doktorunuzveyaeczacınızilekonuşunuz.

K ullanmanızgerekendendaha fazlaHUMALOGMIX50kullandıysanız

HUMALOGMIX50 ’denkullanmanızgerekendenfazlasınıkullanmışsanızbirdoktorveyaeczacı

ilekonuşunuz.

EğergerekendendahafazlaHUMALOGMIX50kullanırsanızkan şekeridüzeyinizdedüşüş

görüleb ilir. Kan şekerinizikontrolediniz.Eğerkanşekerinizdüşükse(hafifhipoglisemi),şeker

alınızyadaşekerlibiriçecek içiniz. Dahasonradoktorunuzun önerdiğigibimeyve, bisküviveya

birsandviçyiyinizvebirazdinleniniz. Genelliklebuyöntemhafif kan şekeridüşüklüğü

(hipoglisemi)veyaküçükbir i nsülin dozaşımınıatlatmanızayardımcıolacaktır. Eğerdurumunuz

kötüleşirse, nefesalıp verişinizsıklaşırsavecildinizsoluklaşırsaderhaldoktorunuzabildiriniz.

Ciddikan şekeridüşüklüğü (hipoglisemi)glukagon enjeksiyonu iletedaviedilebilir.Glukagon

enjeksiyonundan sonra şekeryiyinyadaşekerlisıvıalın. Eğerglukagonayanıtvermezseniz,

hastaneyegitmenizgerekecektir. Glukagon hakkındabilgialmak için doktorunuzadanışınız.

EğerHUMALOGMIX50kullanmayıunutursanız

Eğeralmanızgerekenden dahaazHUMALOGMIX50alırsanız,kanşekerinizyükselebilir.Kan

şekerinizikontrolediniz.

7/11

Eğerkanşekerinindüşmesi(hipoglisemi)veyakanşekerinin yükselmesi(hiperglisemi)tedavi

edilmezseçokciddisonuçlarayolaçabilirvebaşağrısı,bulantı,kusma,susuzluk,şuurkaybı,

komahattaölümlesonuçlanabilir(Bkz.Bölüm4- Olasıyanetkiler).

Kanşekeridüşüklüğünü(hipoglisemi)veyakanşekeriyüksekliğini(hiperglisemi)önlemekiçin3

basitadım:

Kaleminizinyad akartuşunuzunkaybolmasıveyahasargörmesiihtimallerinekarşı,

yanınızdaherzamanyedekbirşırıngailebirlikteyedekbirHUMALOGMIX50flakon veya

yedekbiruygulamakalemi ilebirlikteyedekbirHUMALOGMIX50 kartuşbulundurunuz.

Herzaman, şekerhastası(diyabetik)olduğunuzugösteren biruyarıyıyanınızdataşıyınız.

Herzamanyanınızdaşekerbulundurunuz.

Unutulan dozlarıdengelemekiçin çiftdozalmayınız.

HUMALOGMIX50 iletedavisonlandırıldığındaoluşabileceketkiler

EğeralmanızgerekendendahaazHUMALOGMIX50alırsanız,kanşekerindebiryükselme

ortayaçıkabilir. Doktorunuzaksinisöylemediğitakdirdealdığınızinsülinideğiştirmeyiniz.

Eğerbuürününkullanımıhakkındailavesorularınızvarsa,doktorunuzaveyaeczacınıza

danışınız.

4. Olasıyanetkilernelerdir?

Tüm ilaçlargibi HUMALOGMIX50’n iniçeriğindebulunanmaddelereduyarlıolankişilerdeyan

etkilerolabilir. Ancak buherkesteyan etkigörüldüğü anlamınagelmez.

Aşağıdakilerdenbiriolursa,HUMALOGMIX50’yikullanmayıdurdurunuzveDERHAL

doktorunuzabildiriniz veya sizeenyakınhastaneninacilbölümünebaşvurunuz:

Kanşekerinindüşmesi(hipoglisemi)

Sistemikalerji

endiniaşağıdakibelirtilerilegösterir:

-Tümvücuttadöküntü

-Nefesalmada zorluk

- Hırıltılısolunum

- Kan basıncındadüşme

-Kalpat ışındahızlanma

-Terleme

Bunlarınhepsiçokciddiyanetkilerdir.Eğerbunlardanbirisizdemevcutise,sizinHUMALOG

MIX50’ye karşıciddialerjinizvardemektir.Aciltıbbimüdahaleyeveyahastaneyeyatırılmanıza

gerekolabilir.

Bu çok ciddiyanetkilerin hepsioldukçaseyrekgörülür.

Sıklıklaraşağıdakişekildetanımlanır:

8/11

Çokyaygın(≥1/10);yaygın(≥1/100 ila<1/10);yaygınolmayan(≥1/1,000 ila<1/100);

seyrek( ≥1/10,000 ila<1/1,000);çok seyrek (<1/10,000), bilinmiyor(eldekiverilerden

hareketletahminedilemiyor).

Yaygın

Lokalalerji:Bazıinsanlarinsülinenjeksiyonuyapılanbölgedekızarıklık,şişmeveyakaşıntı

hissedebilir. Bu durumgenelliklebirkaçgün veyahaftaiçerisindedüzelir.

Yaygın olmayan

Enjeksiyonbölgesideğişiklikleri:Sıkenjeksiyonabağlıolarakobölgedeciltaltıdokusunun

kalınlaşmasıveyaçukurlaşması(lipodistrofi).Eğerenjeksiyonbölgesindederinizin

kalınlaştığınıveyaçukurlaştığınıfarkedersenizdoktorunuzabildiriniz.

Bilinmiyor

İnsülin tedavisinin başlangıcındaveyakanglukozunu kontroletmek için tedavideyapılan

değişimsırasındaödem(örneğin;kollarda, bileklerdeşişme, su tutulması)raporlanmıştır.

Eğerbukullanmatalimatındabahsigeçmeyenherhangibiryanetkiilekarşılaşırsanız

doktor unuzu veyaeczacınızıbilgilendiriniz.

Şekerhastalığında sıkgörülenproblemler

A- Kanşekeridüşüklüğü(Hipoglisemi)

an şekerinizin düşmesi(hipoglisemi)kanınızdayeterinceşekerolmadığıanlamınagelir.Bunun

sebebi aşağıdakilerolabilir;

HUMALOGMIX50 yadabaşkainsüliniçok fazlakullanıyorsanız,

Ö ğünatlıyoryadageciktiriyorveyadiyetinizideğiştiriyorsanız,

Bir öğünden hemen önceyadahemen sonraçokfazlafizikselaktivitedebulunuyoryadaiş

yapıyorsanız,

B irenfeksiyonyadahastalığınız(özellikleishalyadakusma)varsa,

İnsülin ihtiyacınızdabirdeğişiklikvarsayada

B öbrekyadakaraciğerinizdevarolan birsorun dahadakötüleşiyorsa.

Alkolvebazıilaçlarkandakişekerdüzeyinizietkileyebilir.

an şekerinizindüşmesininilkbelirtilerigenellikleçabukbelliolurveaşağıdakileriiçerir:

Yorgunluk

Sinirlilikyadatitreme

Başağrısı

Kalp atışındahızlanma

Bulantı

Soğuk terleme

Uyarısemptomlarınıtanımaktahenüzçokeminolmadığınızda,kanşekeridüşüklüğünedeniyle

araba kullan magibisiziveyabaşkalarınıriskesokabilecek durumlaraengelolunuz.

9/11

B- Kanşekeriyüksekliği(hiperglisemi)vediyabetikketoasidoz

Kan şekerininyükselmesi(hiperglisemi)vücudunuzdayeterinceinsülin olmadığıanlamına

gelir.

Kan şekerinizinyükselmesi(hiperglisemi)aşağıdakinedenlerden olabilir:

HUMALOG MIX50 yadadiğerinsülininizialmamak

Doktorunuzunsize söylediğinden dahaazinsülin almak

Diyetinizin izin verdiğinden çok dahafazlasınıyemekyada

A teş, enfeksiyon veyaduygusalstres

Kan şekerininyükselmesi(hiperglisemi)şekerhastalığınınensıkrastlananveiyitedaviedilseler

bilehayatıtehditedenakutkomplikasyonlarındanolandiyabetik ketoasidozaneden olabilir.Bu

rahatsızlıkta,vücuttakiinsülinseviyelerininyetersizoluşu,kanşekerinin(glukoz)yüksek

olmasınavekandaketonadıverilenmaddelerinbirikmesine(ketoasidoz)nedenolur.Diyabetik

ketoasidoz, tedaviğitakdirde, komayahattaölümeneden olabilir.

Diyabetikketoasidozgenelliklehastalıkveyabaşkabirsağlıksorunugibi,stresli birolayile

tetiklenir.Burahatsızlıkaynızamandainsülintedavisininyetersizolmasındandailerigelebilir.

Diyabetikketoasidozençoktip1diyabetibulunankişilerdeyaygındır,ancaktip2diyabeti

bulunankişilerdedegörülebilir.Diyabetikketoasidozkişinindiyabetinekoyduranilkbulgusu

olabilir.

Belirtilersaatlervegünleriçerisindeortayaçıkabilirveaşağıdakileriiçerir:

Uykulu hissetmek

Yüzkızarması

Susuzluk

İştahsızlık

Nefesteaseton kokusu

Bulantıyadakusma

Ciddibelirtiler,sıkvederinnefesalıpvermevenabzınhızlanmasıdır.Böylebirdurumda

hementıbbiyardımalınız.

C- Hastalık

zellikleeğerhastahissediyorsanızya da hastaysanızihtiyaçduyduğunuzinsülinmiktarı

değişebilir.Normalolarakyemekyemediğinizdebileinsülineihtiyacınızvardır.İdraryada

kantesti yaptırınız, hastaiken uyguladığınızkurallarıuygulayınızvedoktorunuzabildiriniz.

Yanetkilerinraporlanması

KullanmaTalimatındayeralanveyaalmayanherhangibiryanetkimeydanagelmesidurumunda

hekiminiz,eczacınızveyahemşirenizilekonuşunuz.Ayrıcakarşılaştığınızyanetkileri

www.titck.gov.trsitesindeyeralan“İlaçYanEtkiBildirimi”ikonunatıklayarakyada080031400

08numaralıyanetkibildirimhattınıarayarakTürkiyeFarmakovijilansMerkezi(TÜFAM)’ne

bildiriniz.Meydanagelenyanetkileribildirerekkullanmaktaolduğunuzilacıngüvenliliğihakkında

dahafazlabilgiedinilmesinekatkısağlamışolacaksınız.

10/11

5.HUMALOGMIX50’nins aklanması

HUMALOGMIX50’y içocuklarıngöremeyeceği,erişemeyeceğiyerlerdeveambalajında

saklayınız.

İlkkullanımakadarHUMALOGMIX50’yi(2°C–8°C)arasındabuzdolabındasaklayınız.

Dondurmayınız.Donmuşürünleriçözüpkullanmayınız.KullanmayabaşladığınızHUMALOG

MIX50’yi odasıcaklığında(30°C’ninaltında)28günekadarsaklayabilirsiniz.Kullandığınız

kartuşlarıbuzdolabındasaklamayınız.Aşırısıcakvedirektgüneşışığıaltındabırakmayınız.

Kalemeyerleştirilmişkartuşlarıiğnetakılıolaraksaklamayınız.

Son kullanmatarihiyleuyumlu olarakkullanınız.

AmbalajdakivekartuşetiketindekisonkullanmatarihindensonraHUMALOGMIX50’yi

kullanmayınız.

Kartuşlarınsıksıkkontroledilmesiveiçindetopaklarvarsayadabeyazparçacıklarkartuşundibi

yadaduvarınayapışarakdonukbirgörünümoluşturuyorsaHUMALOGMIX50’nin

kullanılmamasıgerekir.Yapacağınızherenjeksiyondan öncekontrolediniz.

Eğerüründeve/veyaambalajındabozukluk fark edersenizHUMALOGMIX50’yikullanmayınız.

ÇevreyikorumakamacıylakullanmadığınızHUMALOGMIX50’yişehirsuyunaveyaçöpe

atmayınız. Bu konuda eczacınıza danışınız.

RuhsatSahibi:

LillyİlaçTicaretLtdŞti

AcıbademMah. Çeçen Sokak

AkasyaAcıbademKentEtabı

ABlok Kat:3

34660 Üsküdar/İstanbul

Tel:0 216 554 00 00

Faks:0 216 474 71 99

Üretici:

Eli LillyItaliaS.p.A.

ViaA. Gramsci, 731-733

50019 Sesto Fiorentino, (FI)

İtalya

Bu kullanma talimatı../../....tarihindeonaylanmıştır.

11/11

21-6-2018

FDA approves automated insulin delivery and monitoring system for use in younger pediatric patients

FDA approves automated insulin delivery and monitoring system for use in younger pediatric patients

FDA approves automated insulin delivery and monitoring system for use in younger pediatric patients

FDA - U.S. Food and Drug Administration

22-10-2018

EU/3/15/1532 (Sirius Regulatory Consulting EU Limited)

EU/3/15/1532 (Sirius Regulatory Consulting EU Limited)

EU/3/15/1532 (Active substance: Insulin human) - Transfer of orphan designation - Commission Decision (2018)6985 of Mon, 22 Oct 2018

Europe -DG Health and Food Safety

27-9-2018

We want to help patients/caregivers know how to use pen needles correctly. FDA received reports of patients using standard pen needles to inject insulin w/o removing the inner needle cover. The cover stopped patients from getting the right amnt of insulin

We want to help patients/caregivers know how to use pen needles correctly. FDA received reports of patients using standard pen needles to inject insulin w/o removing the inner needle cover. The cover stopped patients from getting the right amnt of insulin

We want to help patients/caregivers know how to use pen needles correctly. FDA received reports of patients using standard pen needles to inject insulin w/o removing the inner needle cover. The cover stopped patients from getting the right amnt of insulin https://go.usa.gov/xPWZq  pic.twitter.com/LT9SptJge1

FDA - U.S. Food and Drug Administration

24-9-2018

Ryzodeg (Novo Nordisk A/S)

Ryzodeg (Novo Nordisk A/S)

Ryzodeg (Active substance: Insulin degludec/insulin aspart) - Centralised - Yearly update - Commission Decision (2018)6242 of Mon, 24 Sep 2018

Europe -DG Health and Food Safety

24-9-2018

Tresiba (Novo Nordisk A/S)

Tresiba (Novo Nordisk A/S)

Tresiba (Active substance: Insulin degludec) - Centralised - Yearly update - Commission Decision (2018)6244 of Mon, 24 Sep 2018

Europe -DG Health and Food Safety

28-8-2018

EU/3/18/2061 (Pharma Gateway AB)

EU/3/18/2061 (Pharma Gateway AB)

EU/3/18/2061 (Active substance: Autologous glioma tumour cells treated with antisense molecule directed against the insulin-like growth factor type 1 receptor) - Orphan designation - Commission Decision (2018)5739 of Tue, 28 Aug 2018 European Medicines Agency (EMA) procedure number: EMA/OD/049/18

Europe -DG Health and Food Safety

6-8-2018

Insulin lispro Sanofi (Sanofi-Aventis groupe)

Insulin lispro Sanofi (Sanofi-Aventis groupe)

Insulin lispro Sanofi (Active substance: insulin lispro) - Centralised - Yearly update - Commission Decision (2018)5375 of Mon, 06 Aug 2018

Europe -DG Health and Food Safety

22-6-2018

FDA expands approval of hybrid closed loop system for monitoring and delivering insulin to pediatric patients as young as 7. #cgm #diabetes #pediatrics #fdaapproval #medicaldevice  http://go.usa.gov/xUqgQ pic.twitter.com/wZdrU6tTzf

FDA expands approval of hybrid closed loop system for monitoring and delivering insulin to pediatric patients as young as 7. #cgm #diabetes #pediatrics #fdaapproval #medicaldevice http://go.usa.gov/xUqgQ pic.twitter.com/wZdrU6tTzf

FDA expands approval of hybrid closed loop system for monitoring and delivering insulin to pediatric patients as young as 7. #cgm #diabetes #pediatrics #fdaapproval #medicaldevice http://go.usa.gov/xUqgQ  pic.twitter.com/wZdrU6tTzf

FDA - U.S. Food and Drug Administration

19-6-2018

Insuman (Sanofi-Aventis Deutschland GmbH)

Insuman (Sanofi-Aventis Deutschland GmbH)

Insuman (Active substance: human insulin) - Centralised - Yearly update - Commission Decision (2018)3889 of Tue, 19 Jun 2018

Europe -DG Health and Food Safety

19-6-2018

Lusduna (Merck Sharp and Dohme B.V.)

Lusduna (Merck Sharp and Dohme B.V.)

Lusduna (Active substance: insulin glargine) - Centralised - Transfer Marketing Authorisation Holder - Commission Decision (2018)3918 of Tue, 19 Jun 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/4101/T/6

Europe -DG Health and Food Safety

11-6-2018

Xultophy (Novo Nordisk A/S)

Xultophy (Novo Nordisk A/S)

Xultophy (Active substance: insulin degludec / liraglutide) - Centralised - 2-Monthly update - Commission Decision (2018)3779 of Mon, 11 Jun 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/2647/II/23

Europe -DG Health and Food Safety