HUMALOG

Genel Bilgiler

  • Ticaret Unvanı:
  • HUMALOG MIX 25 100 IU/ML 3ML x5 KARTUS
  • Reçete türü:
  • Normal
  • İçin kullanmak:
  • İnsanlar
  • İlaç türü:
  • allopatik ilaç

Belgeler

Yerelleştirme

  • Bulunduğu ülkeler::
  • HUMALOG MIX 25 100 IU/ML 3ML x5 KARTUS
    Türkiye
  • Dil:
  • Türkçe

Terapötik bilgiler

  • Terapötik alanı:
  • kombinasyonları

Diğer bilgiler

Durum

  • Kaynak:
  • TİTCK - TÜRKİYE İLAÇ VE TIBBİ CİHAZ KURUMU - Türkiye
  • Yetkilendirme durumu:
  • Aktif
  • Yetkilendirme numarası:
  • 8699673954196
  • Yetkilendirme tarihi:
  • 29-01-2013
  • Son Güncelleme:
  • 24-05-2018

Hasta Bilgi broşürü: Ürün Özellikleri Özeti - kompozisyon, endikasyonlar, yan etkiler, dozaj, etkileşimleri, advers reaksiyonlar, gebelik, laktasyon

KULLANMATALİMATI

HUMALOGMIX25100IU/ml 3mlkartuş

Cilt altına uygulanır.

Etkinmadde: İnsülin lispro.

Her1 ml’de, 100 ünite(100IU/ml)insülinlisproiçerir.Her birHUMALOG MIX25300 ünite(3

ml)içerir.

İnsülinlisprolaboratuvarortamında“rekombinantDNAteknolojisi”ileeldeedilmektedir.İnsan

insülininindeğiştirilmişbirformudurvebunedenlediğerhayvanveinsaninsülinlerinden

farklıdır.İnsülinlispropankreastarafındanyapılandoğalbirhormonolaninsaninsülinineçok

benzemektedir.

HUMALOGMIX25 içindeki%25 insülinlisprosudaçözünmüşhaldedir.HUMALOGMIX25

içindeki%75 insülin lispro iseprotamin sülfatlabirliktesüspansiyon haldedir.

Yardımcımaddeler:Protamin sülfat, fenol(1 ml’de0.80 mg), metakrezol(1ml’de1.76mg),

gliserol,dibazik sodyumfosfat.7H

0,çinko oksit,enjeksiyonluk su,asit-bazdengesiniayarlamak

için hidroklorik asitvesodyumhidroksitkullanılabilir.

Builacıkullanmaya başlamadanöncebuKULLANMATALİMATINIdikkatlice

okuyunuz,çünkü sizin içinönemlibilgiler içermektedir.

Kullanma talimatınısaklayınız. Daha sonra tekrarokumaya ihtiyaçduyabilirsiniz.

Eğerilavesorularınızolursa, lütfen doktorunuza veyaeczacınıza danışınız.

Bu ilaçkişiselolaraksizin için reçeteedilmiştir, başkalarına vermeyiniz.

Bu ilacın kullanımısırasında, doktora veya hastaneyegittiğinizdedoktorunuzabu ilacı

kullandığınızısöyleyiniz.

Bu talimatta yazılanlaraaynen uyunuz. İlaçhakkında sizeönerilen dozun dışındayüksek

veyadüşükdozkullanmayınız.

Bu Kullanm a Talimatında:

1.HUMALOGMIX25nedirvene içink ullanılır?

2.HUMALOGMIX25’ikullanmadanöncedikkatedilmesigerekenler

3.HUMALOGMIX25n asılkullanılır?

4. Olasıyanetkilernelerdir?

5.HUMALOGMIX25’ins aklanması

Başlıklarıyeralmaktadır.

1.HUMALOGMIX25nedir veneiçink ullanılır?

HUMALOG MIX25beyaz, sterilbirsüspansiyondur.

HUMALOG MIX25kutusunda3ml’lik5adetsüspansiyon içerenkartuşbulunur.

1/12

HUMALOGMIX25şekerhastalığını(diyabeti)tedavietmekiçinkullanılanhazırbir

süspansiyonkarışımıdır.HUMALOGMIX25içindeki%25insülinlisprosudaçözünmüş

haldedirvebu ilaçtakiinsülin molekülü kısmendeğiştirilmişolduğundannormalinsan

insülinindendahahızlıetkieder.HUMALOGMIX25içindeki%75insülinlisproiseprotamin

sülfatlabirliktesüsp ansiyon haldeolduğundan etkisidahauzundur.

Eğerpankreasınızkanınızdakişekerdüzeyinizikontroledecek kadarinsülin üretmezseşeker

hastalığı(diyabet)oluşur.HUMALOG MIX25sizin kendiinsülininizinyerine geçerveuzun

dönemde kanşekerikontrolüiçinkullanılır.HUMALOGMIX25çokhızlıetkigösterirveinsan

insülininegöreetkisidahauzundur.HUMALOGMIX25’inormalolarakyemekten önceki15

dakikaiçindekullanmalısınız.

DoktorunuzsizeHUMALOG MIX25ilebirlikteuzunetkilibirinsülin de kullanmanızı

söyleyebilir.

Herfarklıtürinsüliniçinayrıkullanmatalimatıbulunmaktadır.Doktorunuzsizesöylemeden

insülininizideğiştirmeyiniz.İnsülininizideğiştirirsenizçok dikkatliolunuz.

2.HUMALOGMIX25’ikullanmadanöncedikkatedilmesigerekenler

HUMALOGMIX25’ia şağıdakidurumlardaKULLANMAYINIZ

Eğer;

Kanşekerinizinçokdüştüğünü(hipoglisemi)hissediyorvedüşünüyorsanız.Bukullanma

talimatınınilerikibölümlerindehafifkanşekeridüşüklüğüilenasılbaşaçıkabileceğiniz

anlatılacaktır.(bkz. Bölüm3-KullanmanızgerekendendahafazlaHUMALOG

kullandıysanız)

İnsülinlisproyakarşıyadaHUMALOGMIX25’iniçindekidiğeryardımcımaddelerekarşı

alerjiniz(aşırıduyarlılık)varsa

HUMALOGMIX25’i aşağıdakidurumlarda DİKKATLİKULLANINIZ

Eğer;

Mevcutinsülintedavinizilekanşekeridüzeyiniziyikontrolediliyorsa,kanşekerinizçok

düştüğündeortayaçıkanuyarıbelirtilerinihissedemeyebilirsiniz.Buuyarıbelirtilerikullanma

talimatınızınilerleyenbölümlerindebelirtilmiştir.Yemeklerinizinezamanyemeniz

gerektiğini,nesıklıktavenekadaregzersizyapmanızgerektiğinidikkatledüşünmelisiniz.

Bununlabirliktekanşekerinizisıksıkölçerekkanşekerseviyeniziyakındantakip

etmelisiniz.

Hayvankaynaklıinsülinkullanımındaninsaninsülininegeçenvekanşekeridüşüklüğü

(hipoglisemi)yaşayanbirkaçkişidedahaazbelirginveyadahafarklışekildeerkenuyarı

belirtilerininolduğugözlenmiştir.Eğersıkolarakkanşekeridüşüklüğüyaşıyorsanızveyakan

şekeridüşüklüğünü hissetmektegüçlük çekiyorsanız, lütfen bunu doktorunuzlakonuşunuz.

Hipokalemi(potasyumdüşüklüğü):Tedaviedilmeyenhipokalemisolunumfelci,ritim

bozukluğuveölümenedenolabilir.HUMALOGKWIKPENvediğerinsülinlerinetki

farklılığınedeniyleklinikolarakyanetkigörülmeriskiolanhastalarda(örneğinoruçtutan,

2/12

otonomiknöropatisi(sinirsistemihastalığı)olanveyapotasyumdüşürücüilaçlarkullananya

da serumpotasyumdüzeylerine hassasiyetgösterenilaç alanhastalar)dikkatedilmelidir.

Tüminsülin pr eparatlarındaolduğugibi,HUMALOG’unetkisüresideğişikbireylerdeyada

aynıkişidedeğişikzamanlardaenjeksiyonbölgesi,kandesteği,sıcaklıkvefizikselaktiviteye

bağlıolarak farklılıklargösterebilir.

Hastafiziksel aktivitesini veyaherzamank iyemekplanınıdeğiştirdiğindehangiinsülin

olursaolsundozayarlamasıyapılmasıgerekebilir.Hastalık,duygusalrahatsızlıkveyastres

sırasındadainsülin gereksinimlerideğişebilir.

Hipoglisemi(kanşekeridüşüklüğü):Diğerinsülinpreparatlarındaolduğugibi,HUMALOG

KWIKPENuygulamasıylailişkilihipoglisemikreaksiyonlarolabilir.Serumglukoz

konsantrasyonlarındakihızlıdeğişimdiyabetlihastalardaglukozdeğerindenbağımsızolarak

hipoglisemisemptomlarınıuyarabilir.

Hipogliseminin erken uya rısemptomlarınıfarklılaştıran veyadahaazbelirgin halegetiren

durumlar;uzun sürelidiyabetöyküsü,yoğun insülin tedavisi, diyabetik nöropatiyadabeta

blokörlergibiilaçlardır.

LokalAlerji:Tüminsülintedavilerindeolduğugibi,hastalardaenjeksiyon bölgesinde

kızarıklık,şişkinlikveyakaşıntıolabilir.Buminörreaksiyonlarbirkaçgünilebirkaçhaftada

düzelirfakatbazıdurumlardaHUMALOGtedavisininkesilmesigerekebilir.Bazen,bu

reaksiyonlarcilt temizlememalzemeleri içindeki iritanlarveyauygun olmayanenjeksiyon

tekniklerigibiinsülinden başkafaktörlerledeilişkiliolabilir.

SistemikAlerji:Ciddi,yaşamıtehditeden,HUMALOGdahilherhangibirinsülinlemeydana

gelengenelalerji.Genelalerjitümvücuttadöküntüye(kaşıntıdahil),nefesdarlığına,hırıltılı

solunuma,tansiyondüşmesi,hızlınabız,veyaterlemeyenedenolabilir.Anafilaktik

reaksiyonundahilolduğuciddisistemikalerjivakalarıhayatıtehditedebilir.Krezolün

enjeksiyonlukpreparatlardayardımcımaddeolarakkullanılmasısonuculokalizereaksiyonlar

veyaygınkasağrısıbildirilmiştir.

Aşağıdakisorulardanherhangibirini‘EVET’şeklindecevaplıyorsanız,doktorunuzaveya

eczacınızadanışınız:

− Son zamanlardahastalandınızmı?

− Böbrek veyakaraciğerhastalığınızvarmı?

−Normalden fazlafizikselaktivitedebulunuyormusunuz?

Alkolalırsanız, ihtiyacınızolan insülin miktarıdeğişebilir.

Yurtdışıseyahatineçıkmayıdüşünüyorsanızbunudadoktorveyaeczacınızabildirmelisiniz.

Ülkeler arasısaatfarkı,enjeksiyonlarınızıveöğünlerinizievdekindenfarklızamanlarda

uygulamanızıgerektirebilir.

Uzun süredirTip 2 diyabetiolanvekalphastalığıolanveyadahaönceinmegeçirmişolan,

pioglitazonveinsüliniletedaviedilenhastalardakalpyetmezliğindeartışgörülmüştür.

Alışılmışındışındanefesdarlığı,anikiloartışıveyaödemgibikalpyetmezliğibelirtileri

yaşarsanızenyakın zamandadoktorunuzu bilgilendiriniz.

Buuyarılargeçmiştekiherhangibirdönemdedahiolsasiziniçingeçerliyselütfendoktorunuza

danışınız.

3/12

HUMALOGMIX25’in yiyecekveiçecekilekullanılması

Normalşartlaraltında,HUMALOG MIX25’iyemeklerdenönceki15dakikaiçindeenjekte

etmelisiniz.Eğergerekirseyemektenhemensonradaenjekteedebilirsiniz.Doktorunuztam

olarakne kadar,ne zama n vehangisıklıktakullanmanızgerektiğinisizesöyleyecektir.

Hamilelik

İlacıkullanmadan öncedoktorunuza veyaeczacınıza danışınız.

Hamileliksırasındainsülintedavisigörenhastalardaşekerhastalığınınkontrolübüyükönem

taşır. Genellikle, insülin gereksinimindehamileliğin ilk 3 ayındaazalma, sonraki6 aylık dönemde

deartışgözlenir.Şekerhastalarına,HUMALOGMIX25kullanırkenhamilekaldıklarındayada

kalmayıdüşündüklerindedurumudoktorlarınabildirmeleritavsiyeedilmelidir.Şekerhastalarının

hamileliğisırasındaşekerdüzeylerivegenelsağlıkdurumlarıdikkatleizlenmelidir.

Tedavinizsırasındahamileolduğunuzufarkedersenizhemendoktorunuzaveyaeczacınıza

danışınız.

Emzirme

İlacıkullanmadan öncedoktorunuza veyaeczacınıza danışınız.

Emzirendiyabetliannelerininsülindozunda,beslenmetarzındayadaherikisindedeğişiklik

yapılmasıgerekebilir.

Araçvemakinekullanımı

Kanşekeridüşüklüğü(hipoglisemi)durumundayaptığınızişekonsantreolabilmevereaksiyon

gösterme yeti lerinizazalabilir.Lütfenkendinizivebaşkalarınıriskaltınasokabilecekbütün

koşullarda(örneğintaşıtveyamakinekullanırken)buolasıproblemiaklınızdabulundurunuz.

Aşağıdakidurumlardataşıtkullanımıiçin doktorunuzun tavsiyesinebaşvurunuz.:

S ık kan şekeridüşüklüğü(hipoglisemi)ataklarıgeçiriyorsanız

K an şekeridüşüklüğü (hipoglisemi)belirtilerinihissedemiyorsanız

HUMALOGMIX25’in içeriğindebulunanbazıyardımcımaddelerhakkındaönemli

bilgiler

HUMALOG MIX25’inherbirmililitresindealerjikreaksiyonlara nedenolabilecekmetakrezol

maddesinden 1.76 mgbulunur.

Butıbbiürünherml’sinde1mmol(23mg)’danazsodyumihtivaeder;yaniesasında“sodyum

içermez”.

Diğerilaçlarilebirliktekullanımı

İnsülinihtiyacınızaşağıdakiilaçlarıaldığınızdadeğişebilir:

Doğumkontrolhapları(doğumkontrolünüsağlamakvegebeliğiengellemekamacıyla

kullanılan hormon ilaçları)

Steroidler(steroidiçerenilaçlar)

İzoniazid (veremtedavisindekullanılan ilaçlar), niasin (B3vitaminiiçeren ilaçlar)velipid

düşürücüilaçlar(kandayükseklipitseviyelerinintedavisindekullanılançeşitlitürde

ilaçlar)

4/12

Tiroidhormontedavisi(tiroidbezindemeydanagelenhastalıklardoğrultusunda

uygulanan tedavi)

Ağızdan alınan şekerilaçları(şekerhastalığıtedavisindekullanılanilaçlar)

Asetil salisilikasit ( ağrıkesici,iltihabıazaltıcı,ateşdüşürücüvekansulandırıcıetkisi

olanilaçlar)

Sülfagrubuantibiyotikler(enfeksiyonasebep olan bakterilerekarşıkullanılan ilaçlar)

Oktreotid (büyümehormonu fazl alığındakullanılanilaçlar)

“Beta

2 stimulanıilaçlar”(ritodrin,salbutamolveyaterbutalingibi)(solukalmayı

kolaylaştıranilaçlar)

Beta- blokörlerveyabazıantidepresanlar(monoaminoksidaz(MAO)inhibitörleri,selektif

serotonin gerialıminhibitörleri)(kalphastalıklarıvebazısinirsistemiilaçları)

Ovülasyon üzerindeetkiliolan danazol( ürogenitalorganhastalıklarınıntedavisinde

kullanılanilaçlar)

KaptoprilveenalaprilgibibazıAnjiyotensin Dönüştürücü Enzim(ADE)inhibitörleri(kan

basıncınıdüzenleyiciilaçlar)

AnjiyotensinIIreseptörblokörüantihipertansifilaçlar(yüksekkanbasıncıtedavisinde

kullanılanilaçlar)

Diüretikilaçlar (idrarsöktürücü),hipertansiyontedavisineyardımcıolmakamacıylaidrar

atılımınıkolaylaştıranvefazlalaştıranilaçlar

Eğerreçeteliyadareçetesizherhangibirilacışuandakullanıyorsanızveyasonzamanlarda

kullandınızsa lütfen doktorunuza veya eczacınızabunlarhakkında bilgiveriniz.

3.HUMALOGMIX25n asılkullanılır?

3 ml’likkartuşsadece3ml’likkalemlerilekullanımiçindir.

İlacınızıeczanedenaldığınızdakutuvekartuşetiketini insülinismi vetipi içinkontrol

ediniz.DoktorunuzunsizekullanmanızısöylediğiHUMALOGMIX25’ialdığınızdanemin

olunuz.

HUMALOGMIX25’iherzaman doktorunuzun sizesöylediğişekildekullanınız.Emin

olmadığınızdurumdadoktorunuzasorarak kontrolediniz.

Olasıhastalıkbulaşmalarınıönlemekiçin,iğneucudeğişmişolsabileherbirkartuştekbirhasta

tarafındankullanılmalıdır.

Uygunkullanımvedoz/uygulama sıklığıiçintalimatlar:

Normalşartlaraltında,HUMALOGMIX25’iyemeklerdenönceki15dakikaiçindeenjekte

etmelisiniz. Eğergerekirseyemekten hemen sonradaenjekteedebilirsiniz.

Doktorunuztamolaraknekadar,nezamanvehangisıklıktakullanmanızgerektiğinisize

söyleyecektir.Sadecesiziniçinolanbutalimatlaratamolarak uyunuzvedoktorunuzu düzenli

olarak ziyaretediniz.

5/12

Eğerkullandığınızinsülintipini(örneğinbirinsanveyahayvaninsülinindenbirHumalog

ürününe)değiştirirseniz,eskisindendahaazveyaçokmiktardaalmanızgerekebilir.Budurum

sadeceilkenjeksiyoniçinuygulanabilirveyahaftalarveyaaylarcasürenkademelibirdeğişiklik

yapılabilir.

Uygulama yoluvemetodu:

HUMALOGMIX25’isadececiltaltınaenjekteediniz.Değişikuygulamayollarıkullanarak

uygulamayınız.

HUMALOGMIX25 hiçbirkoşuldadamaryoluyla(intravenöz)enjekteedilmemelidir.

HUMALOGMIX25’in hazırlanması

Kullanmadanhemenöncekartuşuiçerdiğiinsülinsüspansiyonubulanıkyadasütgibibir

rünümalıncayakadar,ikielinizinarasındaonkezilerigeriyuvarlayınızveardındanyineon

kezbirelinizle180 o

yukarıaşağıçevirerekkarıştırınız.Bulanıkyadasütgibibirgörünüm

oluşmazsa,yukarıdabelirtilenişlemiiçerikkarışıncayakadartekrarediniz.Kartuşlarkarıştırmayı

kolaylaştırmakiçinküçükcamboncukiçerir.Dozuntamolarakölçülmesiniengelleyebilecek

köpürmelerenedenolabileceğinden,kartuşçokşiddetliçalkalanmamalıdır.Kartuşlarınsıksık

kontroledilmesiveiçindetopaklarvarsayadabeyazparçacıklarkartuşundibiyadaduvarına

yapışarakdonukbirgörünümoluşturuyorsaHUMALOGMIX25’inkullanılmamasıgerekir.

Yapacağınızherenjeksiyondan öncekontrolediniz.

Kalemin kullanımahazırhalegetirilmesi(İlaçkutunuzuniçindeyeralanKalemKullanım

Kılavuzunu okuyunuz)

Öncelikleelleriniziyıkayınız. Kartuşun kauçuk contasınıdezenfekteediniz.

HUMALOGMIX25 kartuşlarıyalnızcauygunCEişaretlikalemlerilekullanmalısınız.

LütfenkalemilebirliktesunulantalimattaHumalog yadaLillykartuşlarının

belirtilmişolduğundaneminolunuz.3ml’likkartuşsadece3ml’likkalemiçin

uygundur.

Kalemilebirliktesunulan talimatlarıokuyunuz. Kartuşu kalemiçineyerleştiriniz.

Temizb iriğnekullanınız. (İğnelerambalajiçindeyeralmamaktadır).

Dozu 1yada2üniteyeayarlayınız. Dahasonrakalemiyukarıgelecek şekildetutunuzveolası

havakabarcıklarınınyukarıçıkmasıiçinkaleminyantarafınahafifçevurunuz.İğneninucu

halenyu karıbakacakşekildetutarkenenjeksiyondüğmesinebasınız.Buişlemeiğnedenbir

damla HUMALOGMIX25gelinceyekadardevamediniz. Kalemdehalen küçükhava

kabarcıklarıkalmışolabilirkibunlarzararsızdır.Ancak,havakabarcıklarıçokbüyükse

insülin dozunuzu etkileyebilir.

HUMALOGMIX25’inenjekte edilmesi

Enjeksiyonyapmadanönce,enjeksiyonyapılacakbölgeyisizebelirtildiğişekildetemizleyiniz.

Sizeöğretildiğibiçimdeciltaltınaenjekteediniz.Doğrudandamariçineenjeksiyonyapmayınız.

Dozun tamamınıaldığınızdaneminolmakiçinenjeksiyonutamamladıktansonra,iğneyideri

altında5saniyekadartutunuz.Enjeksiyonyaptıktanhemensonraenjeksiyonbölgesini

ovuşturmayınız.Ensonuygulanannoktanınenaz1cmuzağınaveherseferinde,sizegösterildiği

gibienjeksiyonyapılan bölgelerisırailedeğiştirdiğinizden emin olunuz.

6/12

Enjeksiyonsonrası

Enjeksiyonuyaparyapmaz,iğnedışkapağınınyardımıylaiğneyikaleminucundançıkarınız.Bu

işleminsülinisteriltutacakvesızıntıyıönleyecektir.Ayrıcahavanınkalemiçinetekrargirmesini

veiğnenintıkanmasınıdaengelleyecektir.İğnelerinizibaşkalarıylapaylaşmayınız.Kaleminizi

başkalarıylapaylaşmayınız.Kaleminizinkapağınıkapalıtutunuz.Kartuşukaleminiçinde

bırakınız.

Daha sonrakienjeksiyonlar

Herenjeksiyondan önce,1 veya2 üniteçevirinizve kalemi iğnesiyukarıgelecekşekildetutarak

iğneninucundanbirdamlaHUMALOGMIX25çıkanakadarenjeksiyondüğmesinebasınız.

KartuşüzerindekiölçeksizeyaklaşıkkaçüniteHUMALOG MIX25kaldığınıgösterir.Ölçekteki

aralıklardanherbiriyaklaşık20 ünitedir..Eğerdozunuziçinyeterlimiktarkalmadıysa,kartuşu

değiştirin.

Herhangi birHUMALOGMIX25 kartuşuniçinebaşkabirinsülinkarıştırmayınız.Kartuş

boşalmışsa, tekrarkullanmayınız.

Değişikyaşgrupları:

Çocuklardakullanımı:HUMALOG MIX25hemyetişkinlerdehemdeçocuklardakullanımiçin

uygundur.HUMALOG MIX25’in 12yaşındanküçükçocuklardauygulanması,yalnızcabeklenen

yararlarregülerinsülinden fazlaolduğundadüşünülmelidir.

Yaşlılardakullanımı:HUMALOG MIX25yaşlılardakullanımiçin uygundur.

Özelkullanımdurumları:

Böbrek/karaciğeryetmezliği

Böbrek vekaraciğeryetmezliğidurumundainsülin gereksinimideğişebilir.

Böbrekvekaraciğerişlevbozukluğuolanhastalardaglukozdüzeylerinin izlenmesiveinsülin

dozundaayarlamayapmak gerekebilir.

EğerHUMALOG MIX25’inetkisininçokgüçlüveyazayıfolduğunadairbirizleniminizvarise

doktorunuzveyaeczacınızilekonuşunuz.

K ullanmanızgerekendendaha fazlaHUMALOG MIX25kullandıysanız

HUMALOGMIX25 ’denkullanmanızgerekendenfazlasınıkullanmışsanızbirdoktorveyaeczacı

ilekonuşunuz.

EğergerekendendahafazlaHUMALOGMIX25kullanırsanızkanşekeridüzeyinizdedüşüş

görülebilir.Kanşekerinizikontrolediniz.Eğerkanşekerinizdüşükse(hafifhipoglisemi),şeker

alınızyadaşekerlibiriçecekiçiniz.Dahasonradoktorunuzunönerdiğigibimeyve,bisküviveya

birsandviçyiyinizvebirazdinleniniz.Genelliklebuyöntemhafifkanşekeridüşüklüğü

(hipoglisemi) veyaküçükbirinsülindozaşımınıatlatmanızayardımcıolacaktır.Eğerdurumunuz

kötüleşirse,nefesalıpverişinizsıklaşırsavecildinizsoluklaşırsaderhaldoktorunuzabildiriniz.

7/12

Ciddikanşekeridüşüklüğü(hipoglisemi)glukagonenjeksiyonuiletedaviedilebilir.Glukagon

enjeksiyonundansonraşekeryiyinyadaşekerlisıvıalın.Eğerglukagonayanıtvermezseniz,

hastaneyegitmenizgerekecektir. Glukagon hakkındabilgialmak için doktorunuzadanışınız.

EğerHUMALOGMIX25’ikullanmayıunutursanız

EğeralmanızgerekendendahaazHUMALOGMIX25alırsanız,kanşekerinizyükselebilir.Kan

şekerinizikontrolediniz.

Eğerkanşekerinindüşmesi(hipoglisemi)veyakanşekerininyükselmesi(hiperglisemi)tedavi

edilmezseçokciddisonuçlarayolaçabilirvebaşağrısı,bulantı,kusma,susuzluk,şuurkaybı,

komahattaölümlesonuçlanabilir(Bkz.Bölüm4- Olasıyanetkiler).

Kanşekeridüşüklüğünü(hipoglisemi)veyakanşekeriyüksekliğini(hiperglisemi)önlemekiçin3

basitadım:

Kaleminizin yadakartuşunuzunkaybolmasıveyahasargörmesiihtimallerinekarşı,

yanınızdaherzamanyedekbirşırıngailebirlikteyedekbirHUMALOGMIX25flakon veya

yedekbiruygulamakalemi ilebirlikteyedekbirHUMALOGMIX25 kartuş

bulundurunuz. Herzaman,şekerhastası(diyabetik)olduğunuzugösterenbiruyarıyıyanınızda

taşıyınız.

Herzamanyanınızdaşekerbulundurunuz.

Unutulan dozlarıdengelemekiçin çiftdozalmayınız.

HUMALOGMIX25 iletedavisonlandırıldığındaoluşabileceketkiler

EğeralmanızgerekendendahaazHUMALOGMIX25alırsanız,kanşekerindebiryükselme

ortayaçıkabilir. Doktorunuzaksinisöylemediğitakdirdealdığınızinsülinideğiştirmeyiniz.

Eğerbuürününkullanımıhakkındailavesorularınızvarsa,doktorunuzaveyaeczacınıza

danışınız.

4. Olasıyanetkilernelerdir?

TümilaçlargibiHUMALOGMIX25’iniçeriğindebulunanmaddelereduyarlıolankişilerdeyan

etkilerolabilir. Ancak buherkesteyan etkigörüldüğü anlamınagelmez.

Aşağıdakilerdenbiriolursa,HUMALOGMIX25’ikullanmayıdurdurunuzveDERHAL

doktorunuzabildiriniz veya sizeenyakınhastaneninacilbölümünebaşvurunuz:

Kanşekerinindüşmesi(hipoglisemi)

Sistemikalerji

Kendiniaşağıdakibelirtilerilegösterir:

-Tümvücuttadöküntü

-Nefesalmada zorluk

- Hırıltılısolunum

- Kan basıncındadüşme

8/12

- Kalp atışındahızlanma

-Terleme

Bunlarınhepsiçokciddiyanetkilerdir.Eğerbunlardanbirisizdemevcutise,sizinHUMALOG

MIX25’ekarşıciddialerjinizvardemektir.Aciltıbbimüdahaleyeveyahastaneyeyatırılmanıza

gerekolabilir.

Bu çok ciddiyanetkilerin hepsioldukçaseyrekgörülür.

Sıklıklaraşağıdakişekildetanımlanır:

Çokyaygın(≥1/10);yaygın(≥1/100 ila<1/10);yaygınolmayan(≥1/1,000 ila<1/100);

seyrek( ≥1/10,000 ila<1/1,000);çok seyrek (<1/10,000), bilinmiyor(eldekiverilerden

hareketletahminedilemiyor).

Yaygın

Lokalalerji:Bazıinsanlarinsülinenjeksiyonuyapılanbölgedekızarıklık,şişmeveyakaşıntı

hissedebilir. Bu durumgenelliklebirkaçgün veyahaftaiçerisindedüzelir.

Yaygın olmayan

Enjeksiyon bölgesi değişiklikleri:Sıkenjeksiyonabağlıolarakobölgedeciltaltıdokusunun

kalınlaşmasıveyaçukurlaşması(lipodistrofi).Eğerenjeksiyonbölgesindederinizin

kalınlaştığınıveyaçukurlaştığınıfarkedersenizdoktorunuzabildiriniz.

Bilinmiyor

İnsülin tedavisinin başlangıcındaveyakanglukozunu kontroletmek için tedavideyapılan

değişimsırasındaödem(örneğin;kollarda, bileklerdeşişme, su tutulması)raporlanmıştır.

Eğerbukullanmatalimatındabahsigeçmeyenherhangibiryanetkiilekarşılaşırsanız

doktorunuzu veyaeczacınızıbilgilendiriniz.

Şekerhastalığındasıkgörülenproblemler

A- Kanşekeridüşüklüğü(Hipoglisemi)

Kan şekerinizin düşmesi(hipoglisemi)kanınızdayeterinceşekerolmadığıanlamınagelir.Bunun

sebebi aşağıdakilerolabilir;

HUMA LOGMIX25yadabaşkainsüliniçok fazlakullanıyorsanız,

Ö ğünatlıyoryadageciktiriyorveyadiyetinizideğiştiriyorsanız,

B iröğünden hemen önceyadahemen sonraçokfazlafizikselaktivitedebulunuyoryadaiş

yapıyorsanız,

Birenfeksiyonya da hastal ığınız(özellikleishalyadakusma)varsa,

İnsülin ihtiyacınızdabirdeğişiklikvarsayada

Böbrekyadakaraciğerinizdevarolan birsorun dahadakötüleşiyorsa.

Alkolvebazıilaçlarkandakişekerdüzeyinizietkileyebilir.

Kan şekerinizin düşmesininilkbelirtilerigenellikleçabukbelliolurveaşağıdakileriiçerir:

9/12

Yorgunluk

Sinirlilikyadatitreme

Başağrısı

Kalp atışındahızlanma

Bulantı

Soğuk terleme

Uyarısemptomlarınıtanımaktahenüzçokeminolmadığınızda,kanşekeridüşüklüğünedeniyle

arab akullanmagibisiziveyabaşkalarınıriskesokabilecek durumlaraengelolunuz.

B- Kanşekeriyüksekliği(hiperglisemi)vediyabetikketoasidoz

Kan şekerininyükselmesi(hiperglisemi)vücudunuzdayeterinceinsülin olmadığıanlamına

gelir.

Kan şekerinizinyükselmesi(hiperglisemi)aşağıdakinedenlerdenolabilir:

HUMALOG MIX25 yadadiğerinsülininizialmamak

Doktorunuzun sizesöylediğinden dahaazinsülin almak

Diyetinizin izin verdiğinden çok dahafazlasınıyemekyada

Ateş, enfeksiyon veyaduygusalstres

Kanşekerininyükselmesi(hiperglisemi)şekerhastalığınınensıkrastlananveiyitedaviedilse

bilehayatıtehditedenakutkomplikasyonlarındanolandiyabetik ketoasidozaneden olabilir. Bu

rahatsızlıkta,vücuttakiinsülinseviyelerininyetersizoluşu,kanşekerinin(glukoz)yüksek

olmasınavekandaketonadıverilenmaddelerinbirikmesine(ketoasidoz)nedenolur.Diyabetik

ketoasidoz, tedav iğitakdirde, komayahattaölümenedenolabilir.

Diyabetikketoasidozgenelliklehastalıkveyabaşkabirsağlık sorunugibi, streslibirolayile

tetiklenir.Burahatsızlıkaynızamandainsülintedavisininyetersizolmasındandailerigelebilir.

Diyabetikketoasidozençoktip1diyabetibulunankişilerdeyaygındır,ancaktip2diyabeti

bulunankişilerdedegörülebilir.Diyabetikketoasidozkişinindiyabetinekoyduran ilk bulgusu

olabilir.

Belirtilersaatlervegünleriçerisindeortayaçıkabilirveaşağıdakileriiçerir:

Uykulu hissetmek

Yüzkızarması

Susuzluk

İştahsızlık

Nefesteaseton kokusu

Bulantıyadakusma

Ciddi belirtiler, sıkvederinnefesalıpvermevenabzınhızlanmasıdır.Böylebirdurumda

hementıbbiyardımalınız.

10/12

C- Hastalık

zellikleeğerhastahissediyorsanızya da hastaysanızihtiyaçduyduğunuzinsülinmiktarı

değişebilir.Normalolarakyemekyemediğinizdebileinsülineihtiyacınızvardır.İdraryada

kantesti yaptırınız, hastaiken uyguladığınızkurallarıuygulayınızvedoktorunuzabildiriniz.

Yan etkilerin raporlanması

KullanmaTalimatındayeralanveyaalmayanherhangibiryanetkimeydanagelmesidurumunda

hekiminiz,eczacınızveyahemşirenizilekonuşunuz.Ayrıcakarşılaştığınızyanetkileri

www.titck.gov.trsitesindeyeralan“İlaçYanEtkiBildirimi”ikonunatıklayarakyada080031400

08numaralıyanetkibildirimhattınıarayarak TürkiyeFarmakovijilansMerkezi(TÜFAM)’ne

bildiriniz.Meydanagelenyanetkileribildirerekkullanmaktaolduğunuzilacıngüvenliliğihakkında

dahafazlabilgiedinilmesinekatkısağlamışolacaksınız.

5.HUMALOGMIX25’ins aklanması

HUMALOG MIX25’içocukl arıngöremeyeceği,erişemeyeceğiyerlerdeveambalajında

saklayınız.

İlkkullanımakadarHUMALOGMIX25’i(2°C–8°C)arasındabuzdolabındasaklayınız.

Dondurmayınız.Donmuşürünleriçözüpkullanmayınız.KullanmayabaşladığınızHUMALOG

MIX25’iodasıcaklığında(30°C’ninaltında)28günekadarsaklayabilirsiniz.Kullandığınız

kartuşlarıbuzdolabındasaklamayınız.Aşırısıcakvedirektgüneşışığıaltındabırakmayınız.

Kalemeyerleştirilmişkartuşlarıiğnetakılıolaraksaklamayınız.

Son kullanmatarihiyleuy umluolarakkullanınız.

AmbalajdakivekartuşetiketindekisonkullanmatarihindensonraHUMALOGMIX25’i

kullanmayınız.

Kartuşlarınsıksıkkontroledilmesiveiçindetopaklarvarsayadabeyazparçacıklarkartuşundibi

yadaduvarınayapışarakdonukbirgörünümoluşturuyorsaHUMALOGMIX25’in

kullanılmamasıgerekir.Yapacağınızherenjeksiyondan öncekontrolediniz.

Eğerüründeve/veyaambalajındabozukluk fark edersenizHUMALOGMIX25’ikullanmayınız.

ÇevreyikorumakamacıylakullanmadığınızHUMALOGMIX25’işehirsuyunaveyaçöpe

atmayınız. Bu konuda eczacınıza danışınız.

RuhsatSahibi:

LillyİlaçTicaretLtdŞti

AcıbademMah. Çeçen Sokak

AkasyaAcıbademKentEtabı

ABlok Kat:3

34660 Üsküdar/İstanbul

Tel:0 216 554 00 00

Faks:0 216 474 71 99

11/12

Üretici:

Eli LillyItaliaS.p.A.

ViaA. Gramsci, 731-733

50019 Sesto Fiorentino, (FI)

İtalya

Bu kullanma talimatı../../....tarihindeonaylanmıştır.

12/12

Document Outline

21-6-2018

FDA approves automated insulin delivery and monitoring system for use in younger pediatric patients

FDA approves automated insulin delivery and monitoring system for use in younger pediatric patients

FDA approves automated insulin delivery and monitoring system for use in younger pediatric patients

FDA - U.S. Food and Drug Administration

22-10-2018

EU/3/15/1532 (Sirius Regulatory Consulting EU Limited)

EU/3/15/1532 (Sirius Regulatory Consulting EU Limited)

EU/3/15/1532 (Active substance: Insulin human) - Transfer of orphan designation - Commission Decision (2018)6985 of Mon, 22 Oct 2018

Europe -DG Health and Food Safety

27-9-2018

We want to help patients/caregivers know how to use pen needles correctly. FDA received reports of patients using standard pen needles to inject insulin w/o removing the inner needle cover. The cover stopped patients from getting the right amnt of insulin

We want to help patients/caregivers know how to use pen needles correctly. FDA received reports of patients using standard pen needles to inject insulin w/o removing the inner needle cover. The cover stopped patients from getting the right amnt of insulin

We want to help patients/caregivers know how to use pen needles correctly. FDA received reports of patients using standard pen needles to inject insulin w/o removing the inner needle cover. The cover stopped patients from getting the right amnt of insulin https://go.usa.gov/xPWZq  pic.twitter.com/LT9SptJge1

FDA - U.S. Food and Drug Administration

24-9-2018

Ryzodeg (Novo Nordisk A/S)

Ryzodeg (Novo Nordisk A/S)

Ryzodeg (Active substance: Insulin degludec/insulin aspart) - Centralised - Yearly update - Commission Decision (2018)6242 of Mon, 24 Sep 2018

Europe -DG Health and Food Safety

24-9-2018

Tresiba (Novo Nordisk A/S)

Tresiba (Novo Nordisk A/S)

Tresiba (Active substance: Insulin degludec) - Centralised - Yearly update - Commission Decision (2018)6244 of Mon, 24 Sep 2018

Europe -DG Health and Food Safety

28-8-2018

EU/3/18/2061 (Pharma Gateway AB)

EU/3/18/2061 (Pharma Gateway AB)

EU/3/18/2061 (Active substance: Autologous glioma tumour cells treated with antisense molecule directed against the insulin-like growth factor type 1 receptor) - Orphan designation - Commission Decision (2018)5739 of Tue, 28 Aug 2018 European Medicines Agency (EMA) procedure number: EMA/OD/049/18

Europe -DG Health and Food Safety

6-8-2018

Insulin lispro Sanofi (Sanofi-Aventis groupe)

Insulin lispro Sanofi (Sanofi-Aventis groupe)

Insulin lispro Sanofi (Active substance: insulin lispro) - Centralised - Yearly update - Commission Decision (2018)5375 of Mon, 06 Aug 2018

Europe -DG Health and Food Safety

22-6-2018

FDA expands approval of hybrid closed loop system for monitoring and delivering insulin to pediatric patients as young as 7. #cgm #diabetes #pediatrics #fdaapproval #medicaldevice  http://go.usa.gov/xUqgQ pic.twitter.com/wZdrU6tTzf

FDA expands approval of hybrid closed loop system for monitoring and delivering insulin to pediatric patients as young as 7. #cgm #diabetes #pediatrics #fdaapproval #medicaldevice http://go.usa.gov/xUqgQ pic.twitter.com/wZdrU6tTzf

FDA expands approval of hybrid closed loop system for monitoring and delivering insulin to pediatric patients as young as 7. #cgm #diabetes #pediatrics #fdaapproval #medicaldevice http://go.usa.gov/xUqgQ  pic.twitter.com/wZdrU6tTzf

FDA - U.S. Food and Drug Administration

19-6-2018

Insuman (Sanofi-Aventis Deutschland GmbH)

Insuman (Sanofi-Aventis Deutschland GmbH)

Insuman (Active substance: human insulin) - Centralised - Yearly update - Commission Decision (2018)3889 of Tue, 19 Jun 2018

Europe -DG Health and Food Safety

19-6-2018

Lusduna (Merck Sharp and Dohme B.V.)

Lusduna (Merck Sharp and Dohme B.V.)

Lusduna (Active substance: insulin glargine) - Centralised - Transfer Marketing Authorisation Holder - Commission Decision (2018)3918 of Tue, 19 Jun 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/4101/T/6

Europe -DG Health and Food Safety

11-6-2018

Xultophy (Novo Nordisk A/S)

Xultophy (Novo Nordisk A/S)

Xultophy (Active substance: insulin degludec / liraglutide) - Centralised - 2-Monthly update - Commission Decision (2018)3779 of Mon, 11 Jun 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/2647/II/23

Europe -DG Health and Food Safety