HUMALOG

Genel Bilgiler

  • Ticaret Unvanı:
  • HUMALOG 100 IU/ML 10 ML SOLUSYON ICEREN FLAKON
  • Reçete türü:
  • Normal
  • İçin kullanmak:
  • İnsanlar
  • İlaç türü:
  • allopatik ilaç

Belgeler

Yerelleştirme

  • Bulunduğu ülkeler::
  • HUMALOG 100 IU/ML 10 ML SOLUSYON ICEREN FLAKON
    Türkiye
  • Dil:
  • Türkçe

Terapötik bilgiler

  • Terapötik alanı:
  • insülin 70/30

Diğer bilgiler

Durum

  • Kaynak:
  • TİTCK - TÜRKİYE İLAÇ VE TIBBİ CİHAZ KURUMU - Türkiye
  • Yetkilendirme durumu:
  • Aktif
  • Yetkilendirme numarası:
  • 8699673774152
  • Yetkilendirme tarihi:
  • 24-11-2015
  • Son Güncelleme:
  • 24-05-2018

Hasta Bilgi broşürü: Ürün Özellikleri Özeti - kompozisyon, endikasyonlar, yan etkiler, dozaj, etkileşimleri, advers reaksiyonlar, gebelik, laktasyon

KULLANMATALİMATI

HUMALOG100IU/ml10 mlsolüsyoniçerenflakon

Cilt altına uygulanır.

Etkinmadde: İnsülin lispro.

Her1 ml’de, 100 ünite(100IU/ml)insülinlisproiçerir.Her bir HUMALOG1000 ünite(10ml)

içerir.

İnsülinlisprolaboratuvarortamında“rekombinantDNAteknolojisi”ileeldeedilmektedir.İnsan

insülininindeğiştirilmişbirformudurvebunedenlediğerhayvanveinsaninsülinlerinden

farklıdır.İnsülinlispropankreastarafındanyapılandoğalbirhormonolaninsaninsülinineçok

benzemektedir.

Yardımcımaddeler:Metakrezol(1 ml’de3.15mg),gliserol,dibazik sodyumfosfat.7H

0,

çinko oksit,enjeksiyonluk su,asit-bazdengesiniayarlamak için hidroklorik asitvesodyum

hidroksitkullanılabilir.

Builacıkullanmaya başlamadanöncebuKULLANMATALİMATINIdikkatlice

okuyunuz,çünkü sizin için önemlibilgileriçermektedir.

Kullanma talimatınısaklayınız. Daha sonra tekrarokumaya ihtiyaçduyabilirsiniz.

Eğerilavesorularınızolursa, lütfen doktorunuza veyaeczacınıza danışınız.

Builaç ki şiselolaraksizin için reçeteedilmiştir, başkalarına vermeyiniz.

Bu ilacın kullanımısırasında, doktora veya hastaneyegittiğinizdedoktorunuzabu ilacı

kullandığınızısöyleyiniz.

Bu talimatta yazılanlaraaynen uyunuz. İlaçhakkında sizeönerilen dozun dışındayüksek

veyadüşükdozkullanmayınız.

BuKullanma Talimatında:

1.HUMALOGnedirvene içink ullanılır?

2.HUMALOG’ukullanmadanöncedikkatedilmesigerekenler

3.HUMALOGn asılkullanılır?

4. Olasıyanetkilernelerdir?

5.HUMALOG’uns aklanması

Başlıklarıyeralmaktadır.

1.HUMALOGnedir veneiçink ullanılır?

HUMALOG steril,berrak,renksiz,sıvıbirçözeltidir.HUMALOGkutusunda10ml’lik1adet

çözeltiiçerenflakonbulunur.

HUMALOG şekerhastalığını(diyabeti)tedavietmekiçinkullanılır.Builaçtakiinsülin molekülü

kısmendeğiştirilmişolduğundan normalinsan insülininden dahahızlıetkieder.

1/11

Eğerpankreasınızkanınızdakişekerdüzeyinizikontroledecek kadarinsülin üretmezseşeker

hastalığı(diyabet)oluşur.HUMALOGsizin kendiinsülininizinyerine geçerveuzun dönemde

kanşekerikontrolüiçinkullanılır.HUMALOG çokhızlıetkigösterirveinsaninsülinine göre

etkisi (2-5 saa t)dahakısasüredesonaerer.

HUMALOG’u normalolarakyemekten önceki15 dakikaiçinde kullanmalısınız.

DoktorunuzsizeHUMALOGilebirlikteuzunetkilibir insülindekullanmanızısöyleyebilir.Her

farklıtürinsüliniçinayrıkullanmatalimatıbulunmaktadır.Doktorunuzsizesöylemeden

insülininizideğiştirmeyiniz.İnsülininizideğiştirirsenizçok dikkatliolunuz.

2.HUMALOG’ukullanmadanöncedikkatedilmesigerekenler

HUMALOG’ua şağıdakidurumlardaKULLANMAYINIZ

Eğer;

K an şekerinizinçokdüştüğünü(hipoglisemi)hissediyorvedüşünüyorsanız. Bu kullanma

talimatınınilerikibölümlerindehafifkan şekeridüşüklüğüilenasılbaşaçıkabileceğiniz

anlatılacaktır.(bkz. Bölüm3-Kullanmanızgerekenden dahafazlaHUMALOG

kullandıysanız)

İnsülinlisproyakarşıyadaHUMALOG’uniçindekidiğeryardımcımaddelerekarşıalerjiniz

aşırıduyarlılık) varsa

HUMALOG’u aşağıdakidurumlarda DİKKATLİKULLANINIZ

Eğer;

Mevcutinsülin tedavinizil ekanşekeridüzeyiniziyikontrolediliyorsa,kanşekerinizçok

düştüğündeortayaçıkanuyarıbelirtilerinihissedemeyebilirsiniz.Buuyarıbelirtilerikullanma

talimatınızınilerleyenbölümlerindebelirtilmiştir.Yemeklerinizinezamanyemeniz

gerektiğini,nesıklıktavenekadaregzersizyapmanızgerektiğinidikkatledüşünmelisiniz.

Bununlabirliktekanşekerinizisıksıkölçerekkanşekerseviyeniziyakındantakip

etmelisiniz.

Hayvankaynaklıinsülinkullanımından insaninsülininegeçen vekanşekeridüşüklüğü

(hipoglisemi) yaşayanbirkaçkişidedahaazbelirginveyadahafarklışekildeerkenuyarı

belirtilerinin olduğugözlenmiştir.Eğersıkolarakkanşekeridüşüklüğüyaşıyorsanızveyakan

şekeridüşüklüğünühissetmektegüçlükçekiyorsanız, lütfen bunu doktorunuzlakonuşunuz.

Hipokalemi(potasyumdüşüklüğü):Tedaviedilmeyenhipokalemisolunumfelci,ritim

bozukluğuveölümenedenolabilir.HUMALOGKWIKPENvediğerinsülinlerinetki

farklılığınedeniyleklinikolarakyanetkigörülmeriskiolanhastalarda(örneğinoruçtutan,

otonomiknöropatisi(sinirsistemihastalığı)olanveyapotasyumdüşürücüilaçlarkullananya

da serumpotasyumdüzeylerine hassasiyetgösterenilaç alanhastalar)dikkatedilmelidir.

Tüminsülinpreparatlarındaolduğugibi,HUMALOG’unetkisüresideğişikbireylerdeyada

aynıkişidedeğişikzamanlardaenjeksiyonbölgesi,kandesteği,sıcaklıkvefizikselaktiviteye

bağlıolarak farklılıklargösterebilir.

2/11

Hastafiziksel aktivite siniveyaherzamankiyemekplanınıdeğiştirdiğindehangiinsülin

olursaolsundozayarlamasıyapılmasıgerekebilir.Hastalık,duygusalrahatsızlıkveyastres

sırasındadainsülin gereksinimlerideğişebilir.

Hipoglisemi(kanşekeridüşüklüğü):Diğerinsülinpreparatlarındaolduğugibi,HUMALOG

KWIKPENuygulamasıylailişkilihipoglisemikreaksiyonlarolabilir.Serumglukoz

konsantrasyonlarındakihızlıdeğişimdiyabetlihastalardaglukozdeğerindenbağımsızolarak

hipoglisemisemptomlarınıuyarabilir.

Hipo gliseminin erken uyarısemptomlarınıfarklılaştıran veyadahaazbelirgin halegetiren

durumlar;uzun sürelidiyabetöyküsü,yoğun insülin tedavisi, diyabetik nöropatiyadabeta

blokörlergibiilaçlardır.

LokalAlerji:Tüminsülintedavilerindeolduğugibi, hastalardaenjeksiyon bölgesinde

kızarıklık,şişkinlikveyakaşıntıolabilir.Buminörreaksiyonlarbirkaçgünilebirkaçhaftada

düzelirfakatbazıdurumlardaHUMALOGtedavisininkesilmesigerekebilir.Bazen,bu

reaksiyonlarcilt temizlememalzemeleriiçindekiiritanlarveyauygun olmayanenjeksiyon

tekniklerigibiinsülinden başkafaktörlerledeilişkiliolabilir.

SistemikAlerji:Ciddi,yaşamıtehditeden,HUMALOGdahilherhangibirinsülinlemeydana

gelengenelalerji.Genelalerjitümvücutta dökü ntüye(kaşıntıdahil),nefesdarlığına,hırıltılı

solunuma,tansiyondüşmesi,hızlınabız,veyaterlemeyenedenolabilir.Anafilaktik

reaksiyonundahilolduğuciddisistemikalerjivakalarıhayatıtehditedebilir.Krezolün

enjeksiyonlukpreparatlardayardımcımaddeolarakkullanılmasısonuculokalizereaksiyonlar

veyaygınkasağrısıbildirilmiştir.

A şağıdakisorulardanherhangibirini‘EVET’şeklindecevaplıyorsanız,doktorunuzaveya

eczacınızadanışınız:

− Son zamanlardahastalandınızmı?

−Böbrekveya karac iğerhastalığınızvarmı?

−Normaldenfazlafiziksel aktivitedebulunuyormusunuz?

A lkolalırsanız,ihtiyacınızolan insülin miktarıdeğişebilir.

Y urtdışıseyahatineçıkmayıdüşünüyorsanızbunudadoktorveyaeczacınızabildirmelisiniz.

Ülkeler arasısaatfarkı,enjeksiyonlarınızıveöğünlerinizievdekindenfarklızamanlarda

uygulamanızıgerektirebilir.

UzunsüredirTip2diyabetiolanvekalphastalığıolanveyadahaönceinmegeçirmişolan,

pioglitazonveinsüliniletedaviedilenhastalardakalpyetmezliğindeartışgörülmüştür.

Alışılmışındışındanefesdarlığı,anikiloartışıveyaödemgibikalpyetmezliğibelirtileri

yaşarsanızenyakın zamandadoktorunuzu bilgilendiriniz.

Buuyarılargeçmiştekiherhangibirdönemdedahiolsasiziniçingeçerliyselütfen doktorunuza

danışınız.

HUMALOG’un yiyecekveiçecekilekullanılması

Normalşartlaraltında,HUMALOG’uyemeklerdenönceki15dakika içinde enjekteetmelisiniz.

Eğergerekirseyemektenhemensonradaenjekteedebilirsiniz.Doktorunuztamolarak nekadar,

nezaman vehangisıklıktakullanmanızgerektiğinisizesöyleyecektir.

Hamilelik

İlacıkullanmadan öncedoktorunuza veyaeczacınıza danışınız.

3/11

Hamileliksırasındainsülintedavisigörenhastalardaşekerhastalığınınkontrolübüyükönem

taşır.Genellikle, insülin gereksinimindehamileliğin ilk 3 ayındaazalma, sonraki6 aylık dönemde

deartışgözlenir.Şekerhastalarına,HUMALOGkullanırkenhamilekaldıklarındayadakalmayı

düşündüklerindedurumudoktorlarınabildirmeleritavsiyeedilmelidir.Şekerhastalarının

hamilelikleri sırasındaşekerdüzeylerivegenelsağlık durumlarıdikkatleizlenmelidir.

Tedavinizsırasındahamileolduğunuzufarkedersenizhemendoktorunuzaveyaeczacınıza

danışınız.

Emzirme

İlacıkullanmadan öncedoktorunuza veyaeczacınızadanışınız.

Emzirendiyabetliannelerininsülindozunda,beslenmetarzındayadaherikisindedeğişiklik

yapılmasıgerekebilir.

Araçvemakinekullanımı

Kanşekeridüşüklüğü(hipoglisemi)durumundayaptığınızişekonsantreolabilmevereaksiyon

gösterme yetilerinizazalabilir.Lütfenkendinizivebaşkalarınıriskaltınasokabilecekbütün

koşullarda(örneğintaşıtveyamakinekullanırken)buolasıproblemiaklınızdabulundurunuz.

Aşağıdakidurumlardataşıtkullanımıiçin doktorunuzun tavsiyesinebaşvurunuz.

Sık sık geçirilenkan şekeridüşüklüğü (hipoglisemi)ataklarıgeçiriyorsanız

K an şekeridüşüklüğübelirtilerinihissedemiyorsanız

HUMALOG’u niçeriğindebulunanbazıyardımcımaddelerhakkındaönemlibilgiler

HUMALOG’unherbirmililitresindealerjikreaksiyonlaranedenolabilecekmetakrezol

maddesinden 3.15 mgbulunur.

Butıbbiürünherml’sinde1mmol(23mg)’danazsodyumihtivaeder;yaniesasında“sodyum

içermez”.

Diğerilaçlarilebirliktekullanımı

İnsülinihtiyacınızaşağıdakiilaçlarıaldığınızdadeğişebilir:

Doğumkontrolhapları(doğumkontrolünüsağlamakvegebeliğiengellemekamacıyla

kullanılan hormon ilaçları)

Steroidler(steroidiçerenilaçlar)

İzoniazid (veremtedavisindekullanılan ilaçlar), niasin (B3vitaminiiçeren ilaçlar)velipid

düşürücüilaçlar(kandayükseklipitseviyelerinintedavisindekullanılançeşitlitürde

ilaçlar)

Tiroidhormontedavisi(tiroidbezindemeydanagelenhastalıklardoğrultusunda

uygulanan tedavi)

Ağızdan alınan şekerilaçları(şekerhastalığıtedavisindekullanılanilaçlar)

Asetil salisilikasit ( ağrıkesici,iltihabıazaltıcı,ateşdüşürücüvekansulandırıcıetkisi

olanilaçlar)

Sülfagrubuantibiyotikler(enfeksiyonasebep olan bakterilerekarşıkullanılan ilaçlar)

Oktreotid (büyümehormonu fazlalığındakullanılanilaçlar)

4/11

“Beta

2 stimulanıilaçlar”(ritodrin,salbutamolveyaterbutalingibi)(solukalmayı

kolaylaştıranilaçlar)

Beta- blokörlerveyabazıantidepresanlar(monoaminoksidaz(MAO)inhibitörleri,selektif

serotonin gerialıminhibitörleri)(kalphastalıklarıvebazısinirsistemiilaçları)

Ovülasyon üzerindeetkiliolan danazol( ürogenitalorganhastalıklarınıntedavisinde

kullanılanilaçlar)

KaptoprilveenalaprilgibibazıAnjiyotensin Dönüştürücü Enzim(ADE)inhibitörleri(kan

basıncınıdüzenleyici ilaçlar)

AnjiyotensinIIreseptörblokörüantihipertansifilaçlar(yüksekkanbasıncıtedavisinde

kullanılanilaçlar)

Diüretikilaçlar (idrarsöktürücü),hipertansiyontedavisineyardımcıolmakamacıylaidrar

atılımınıkolaylaştıranvefazlalaştıranilaçlar

Eğerreçeteliyadareçetesizherhangibirilacışuandakullanıyorsanızveyasonzamanlarda

kullandınızsa lütfen doktorunuzaveya eczacınızabunlarhakkında bilgiveriniz.

3.HUMALOGn asılkullanılır?

İlacınızıeczanedenaldığınızdakutuveflakonetiketini insülinismi vetipi içinkontrol

ediniz. DoktorunuzunsizekullanmanızısöylediğiHUMALOG’ualdığınızdaneminolunuz.

HUMALOG’u herzamandoktorunuzunsizesöylediğişekildekullanınız.Eminolmadığınız

durumdadoktorunuza sorarakkontrolediniz.

Flakon uygun birenjektör(100 üniteişaretli)ilekullanılmalıdır.

Uygunkullanımvedoz/uygulama sıklığıiçintalimatlar:

Normalşartlaraltında,HUMALOG’uyemeklerden önceki15 dakikaiçindeenjekteetmelisiniz.

Eğergerekirseyemektenhemensonradaenjekteedebilirsiniz.

oktorunuztamolaraknekadar,nezamanvehangisıklıktakullanmanızgerektiğinisize

söyleyecektir.Sadecesiziniçinolanbutalimatlaratam olarakuyunuzvedoktorunuzu düzenli

olarak ziyaretediniz.

Eğerkullandığınızinsülintipini(örneğinbirinsanveyahayvaninsülininden birHumalog

ürününe)değiştirirseniz,eskisindendahaazveyaçokmiktardaalmanızgerekebilir.Budurum

sadeceilkenjeksiyoniçinuygulanabilirveyahaftalarveyaaylarca sürenkademelibirde ğişiklik

yapılabilir.

Uygulama yoluvemetodu:

HUMALOG’usadececilt altınaenjekteediniz.Kasiçineenjeksiyoneğerdoktorunuztarafından

önerilmişseyapılmalıdır.

HUMALOG ’udamariçineuygulamayınız.Doktorunuzveyadiyabethemşirenizinöğrettiği

şekildeenjeksiyonyapınız.HUMALOG’udamariçine enjeksiyonunusadecedoktorunuz

5/11

yapabilir. Bu da ameliyatyadahastaolmanızdurumundavehastalıktakanşekeriseviyesininçok

yüksek olmasıgibiözeldurumlardayapılabilir.

HUMALOG’un hazırlanması

HUMALO Göncedensudaçözünmüşolduğundan,karıştırmayagerekyoktur.Görünümüyalnız

sugibiolduğusürecekullanmalısınız.Çözelti berrak, renksizolup,içindekatıbeyazparçacıklar

olmamalıdır.Herenjeksiyondanönceçözeltiyikontrolediniz.

HUMALOG’un enjekteedilmesi

Öncelikleelleriniziyıkayınız.

Enjeksiyonyapmadanönce enjeksiyonyapılacakbölgeyisizebelirtildiğişekildetemizleyiniz.

Flakonunkauçuk tıpasınıtemizleyinizancaktıpayıçıkartmayınız.

Temiz,steril birenjektör veiğnekullanarakkauçuktıpayıdelinizveistediğinizmiktarda

HUMALOG’uenjektörleçekiniz .Doktorunuzveyadiyabethemşirenizsizenasılyapılacağını

öğretecektir.İğnelerinizveenjektörlerinizibaşkalarıyla paylaşmayınız.

Sizeöğretildiğibiçimdeciltaltınaenjekteediniz.Doğrudandamariçineenjeksiyon

yapmayınız. Dozun tamamınıaldığınızdan emin olmak için,enjeksiyonu tamamladıktan sonra

iğneucunuderialtında5saniyekadartutunuz. Enjeksiyonyaptığınızbölgeyiovuşturmayınız.

Enjeksiyonu e nsonuygulanannoktanınenaz1cmuzağınauyguladığınızdanve size

gösterildiğigibienjeksiyonyapılanbölgelerisırailedeğiştirdiğinizden emin olunuz. Hangi

enjeksiyonbölgesinikulla ndığınızönemlideğildir,kolunüstkısmı,uyluk,kalçayadakarına

yapıldığındaHUMALOGenjeksiyonunuzinsan insülininegöredahahızlıetkieder.

DoktorunuzHUMALOG’u insan insülinlerinden biri ilekarıştırmanızgerekiyorsasize

söyleyecektir.Örneğineğerbirkarışımenjekteetmenizgerekiyorsa,uzunetkiliinsülinden

önceHUMALOG’uenjektöreçekiniz. Karıştırdıktanhemensonrasıvıyıenjekteediniz.Aynı

şeyiherseferindetekrarlayınız.NormaldeHUMALOG’uinsaninsülinikarışımlarından

birisiylekarıştırmamalısınız.Başkaüreticilerinürettiğiinsülinlerleveyahayvaninsülinleriyle

HUMALOG ’uhiçbirzamankarıştırmamalısınız.

HUMALOG’udamariçineuygulamayınız.Doktorunuzveyadiyabethemşirenizinöğrettiği

şekildeenjeksiyonyapınız.HUMALOG’undamariçine enjeksiyonunusadecedoktorunuz

yapabilir .Budaameliyatyadahastaolmanızdurumundavekanşekeriseviyesininçok

yüksek olmasıgibiözeldurumlardayapılabilir.

HUMALOG’un infüzyonpompasıyla kullanımı

YalnızcabelirliCEişaretliinsülininfüzyonpompalarıinsülinlisproinfüzyonunda

kullanılabilir.İnsülinlisproyuinfüzeetmedenönce,uygunluğunbelirlenmesiiçinüreticinin

talimatlarıyadaözelpompaüzerindeçalışılmalıdır.İnfüzyonpompasıilebirlikteverilen

talimatlarıokuyup uygulayınız.

Pompanıziçin doğru haznevekataterkullanıldığından emin olunuz.

İnfüzyonsetinin (tüpveiğneucu)değişimiinfüzyon setiileverilenürünbilgilerindeki

talimatlaragöreyapılımalıdır.

Hipoglisemiatağıdurumunda,atakçözümleninceyekadarinfüzyondurdurulmalıdır.Eğer

tekararlarsayadakanşekeridüzeyinizdeciddidüşüşolursa,doktorunuzuveyakliniği

bilgilendirinizveinsülininfüzyonunu azaltınızveyadurdurunuz.

6/11

Pompadakibirbozuklukveyainfüzyonsetindekitıkanmaglukozseviyesinihızlayükseltir.

İnsülinakışınınkesilmesindenşüphelenildiğinde,ürüneaittalimatlarıtakipedip, mümkünse

doktorunuzu veyakliniğibilgilendiriniz.

İnfüzyonpompasıilebirliktekullanıldığında,HUMALOGdiğerinsülinlerle

karıştırılmamalıdır.

Değişikyaşgrupları:

Çocuklardakullanımı:HUMALOGhemyetişkinlerdehemdeçocuklardakullanımiçin

uygundur. HUMALOGçocuklarda regülerinsülinekıyaslaavantajlıolduğudurumlarda

uygulanabilir(örneğin,yemeklerebağlıenjeksiyon zamanlaması).

Yaşlılardakullanımı:HUMALOGyaşlılardakullanımiçin uygundur.

Özelkullanımdurumları:

Böbrek /karaciğeryetmezliği

Böbrek vekaraciğeryetmezliğidurumundainsülin gereksinimideğişebilir.

Böbrekvekaraciğerişlevbozukluğuolanhastalardaglukozdüzeylerininizlenmesi veinsülin

dozundaayarlamayapmak gerekebilir.

EğerHUMALOG’un etkisinin çokgüçlüveyazayıfolduğunadairbirizleniminizvarise

doktorunuzveyaeczacınızilekonuşunuz.

K ullanmanızgerekendendaha fazlaHUMALOGkullandıysanız

HUMALOG’da nkullanmanızgerekendenfazlasınıkullanmışsanızbirdoktorveyaeczacıile

konuşunuz.

Eğergerekendendahafazla HUMALOGkullanırsanızkanşekeridüzeyinizdedüşüşgörülebilir.

Kanşekerinizikontrolediniz.Eğerkanşekerinizdüşükse(hafifhipoglisemi),şekeralınızyada

şekerlibiriçecekiçiniz.Dahasonradoktorunuzunönerdiğigibimeyve,bisküviveyabirsandviç

yiyinizvebirazdinleniniz. Genelliklebuyöntemhafif kanşekeridüşüklüğü(hipoglisemi)veya

küçükbir i nsülindozaşımınıatlatmanızayardımcıolacaktır.Eğerdurumunuzkötüleşirse,nefes

alıpverişinizsıklaşırsavecildinizsoluklaşırsaderhaldoktorunuzabildiriniz.Ciddikanşekeri

düşüklüğü(hipoglisemi)glukagonenjeksiyonuiletedaviedilebilir.Glukagon enjeksiyonundan

sonra şekeryiyinizyadaşekerlisıvıalınız.Eğerglukagonayanıtvermezseniz,hastaneye

gitmenizgerek ecektir. Glukagon hakkındabilgialmak için doktorunuzadanışınız.

EğerHUMALOG’ukullanmayıunutursanız

EğeralmanızgerekendendahaazHUMALOGalırsanız,kanşekerinizyükselebilir.Kan

şekerinizikontrolediniz.

Eğerkanşekerinindüşmesi(hipoglisemi)veyakanşekerinin yükselmesi(hiperglisemi)tedavi

edilmezseçokciddisonuçlarayolaçabilirvebaşağrısı,bulantı,kusma,susuzluk,şuurkaybı,

komahattaölümlesonuçlanabilir(Bkz.Bölüm4- Olasıyanetkiler).

7/11

Kanşekeridüşüklüğünü(hipoglisemi)veyakanşekeriyüksekliğini(hiperglisemi)önlemek için3

basitadım:

Herzaman yanınızdayedekbirenjektörilebirlikteyedekbirHUMALOGflakon

bulundurunuz.

Herzaman şekerhastası(diyabetik)olduğunuzu gösteren biruyarıyıyanınızdataşıyınız.

Herza manyanınızdaşekerbulundurunuz.

Unutulan dozlarıdengelemekiçin çiftdozalmayınız.

HUMALOG iletedavisonlandırıldığındaoluşabileceketkiler

EğeralmanızgerekendendahaazHUMALOGalırsanızkanşekerindebiryükselmeortaya

çıkabilir. Doktorunuzaksinisöylemediğitakdirdealdığınızinsülinideğiştirmeyiniz.

Eğerbuürününkullanımıhakkındailavesorularınızvarsa,doktorunuzaveyaeczacınıza

danışınız.

4. Olasıyanetkilernelerdir?

Tüm ilaçlargibi HUMALOG’u niçeriğindebulunanmaddelereduyarlıolankişilerdeyanetkiler

olabilir. Ancak bu herkesteyan etkigörüldüğü anlamınagelmez.

Aşağıdakilerdenbiriolursa,HUMALOG’ukullanmayıdurdurunuzveDERHAL

doktorunuzabildiriniz veya sizeenyakınhastaneninacilbölümünebaşvurunuz:

Kanşekerinindüşmesi(hipoglisemi)

Sistemikalerji

endiniaşağıdakibelirtilerilegösterir:

-Tümvücuttadöküntü

-Nefesalmada zorluk

- Hırıltılısolunum

- Kan basıncındadüşme

- Kalp atışındahızlanma

-Terleme

Bunlarınhepsiçokciddiyanetkilerdir.Eğerbunlardanbirisizde mevcutise,sizinHUMALOG’a

karşıciddialerjinizvardemektir.Aciltıbbimüdahaleyeveyahastaneyeyatırılmanızagerek

olabilir.

Bu çok ciddiyanetkilerin hepsioldukçaseyrekgörülür.

Sıklıklaraşağıdakişekildetanımlanır:

Çokyaygın(≥1/10);yaygın(≥1/100 ila<1/10);yaygınolmayan(≥1/1,000 ila<1/100);

seyrek( ≥1/10,000 ila<1/1,000);çok seyrek (<1/10,000), bilinmiyor(eldekiverilerden

hareketletahminedilemiyor).

8/11

Yaygın

Lokalalerji:Bazıinsanlarinsülinenjeksiyonuyapılanbölgedekızarıklık,şişmeveyakaşıntı

hissedebilir. Bu durumgenelliklebirkaçgün veyahaftaiçerisindedüzelir.

Yaygın olmayan

Enjeksiyonbölgesideğişiklikleri:Sıkenjeksiyonabağlıolarakobölgedeciltaltıdokusunun

kalınlaşmasıveyaçukurlaşması(lipodistrofi).Eğerenjeksiyonbölgesindederinizin

kalınlaştığınıveyaçukurlaştığınıfarkedersenizdoktorunuzabildiriniz.

Bilinmiyor

İnsülin tedavisinin başlangıcındaveyakanglukozunu kontroletmek için tedavideyapılan

değişimsırasındaödem(örneğin;kollarda, bileklerdeşişme, su tutulması)raporlanmıştır.

Eğerbukullanmatalimatındabahsigeçmeyenherhangibiryanetkiilekarşılaşırsanız

doktorunuzu veyaeczacınızıbilgilendiriniz.

Şekerhastalığındasıkgörülenproblemler

A. Kanşekeridüşüklüğü(Hipoglisemi)

an şekerinizin düşmesi(hipoglisemi)kanınızdayeterinceşekerolmadığıanlamınagelir.Bunun

sebebiaşağıdakilerolabilir;

HUMALOG yadabaşkainsüliniçok fazlakullanıyorsanız,

Ö ğünatlıyoryadageciktiriyorveyadiyetinizideğiştiriyorsanız

Bir öğünden hemen önceyadahemen sonraçokfazlafizikselaktivitedebulunuyoryadaiş

yapıyorsanız,

B irenfeksiyonyadahastalığınız(özellikleishalyadakusma)varsa,

İnsülin ihtiyacınızdabirdeğişiklikvarsayada

Böbrekyadaka raciğerinizdevarolan birsorun dahadakötüleşiyorsa.

Alkolvebazıilaçlarkandakişekerdüzeyinizietkileyebilir.

an şekerinizindüşmesininilkbelirtilerigenellikleçabukbelliolurveaşağıdakileriiçerir:

Yorgunluk

Sinirlilikyadatitreme

Başağrısı

Kalp atışındahızlanma

Bulantı

Soğuk terleme

Uyarısemptomlarınıtanımaktahenüzçokeminolmadığınızda,kanşekeridüşüklüğünedeniyle

arabakullanmagibisiziveya başkalarınıriskesokabilecek durumlaraengelolunuz.

9/11

B. Kanşekeriyüksekliği(hiperglisemi)vediyabetikketoasidoz

Kan şekerininyükselmesi(hiperglisemi)vücudunuzdayeterinceinsülin olmadığıanlamına

gelir.

Kan şekerinizinyükselmesi (hiperglisemi)aşağıdakinedenlerden olabilir:

HUMALOG yadadiğerinsülininizialmamak

Doktorunuzunsize söylediğinden dahaazinsülin almak

Diyetinizin izin verdiğinden çok dahafazlasınıyemekyada

A teş, enfeksiyon veyaduygusalstres

Kanşekerininyükselmesi(hiperglisemi)şekerhastalığınınensıkrastlananveiyitedavi

edilsebilehayatıtehditedenakutkomplikasyonlarındanolandiyabetik ketoasidozaneden

olabilir. Burahatsızlıkta,vücuttakiinsülinseviyelerininyetersizoluşu,kanşekerinin(glukoz)

yüksekolmasınavekandaketonadıverilenmaddelerinbirikmesine(ketoasidoz)nedenolur.

Diyabetik ketoasidoz, tedaviedilmed iğitakdirde, komayahattaölümeneden olabilir.

Diyabetikketoasidozgenelliklehastalıkveyabaşkabirsağlıksorunugibi,streslibirolayile

tetiklenir.Burahatsızlıkaynızamandainsülintedavisininyetersizolmasındandailerigelebilir.

Diyabetikketoasidozençoktip1diyabetibulunankişilerdeyaygındır,ancaktip2diyabeti

bulunankişilerdedegörülebilir.Diyabetikketoasidozkişinindiyabetintanıkoyduranilkbulgusu

olabilir.

Belirtilersaatlerv egünleriçerisindeortayaçıkabilirveaşağıdakileriiçerir:

Uykulu hissetmek

Yüzkızarması

Susuzluk

İştahsızlık

Nefesteaseton kokusu

Bulantıyadakusma

Ciddi belirtiler, sıkvederinnefesalıpvermevenabzınhızlanmasıdır.Böylebirdurumda

hemen tıbbiyardımalınız.

C. Hastalık

zellikleeğerhastahissediyorsanızya da hastaysanızihtiyaçduyduğunuzinsülinmiktarı

değişebilir.Normalolarakyemekyemediğinizdebileinsülineihtiyacınızvardır.İdraryada

kantesti yaptırınız, hastaiken uyguladığınızkurallarıuygulayınızvedoktorunuzabildiriniz.

Yan etkilerin raporlanması

KullanmaTalimatındayeralanveyaalmayanherhangibiryanetkimeydanagelmesidurumunda

hekiminiz,eczacınızveyahemşirenizilekonuşunuz.Ayrıcakarşılaştığınızyanetkileri

www.titck.gov.trsitesindeyeralan“İlaçYanEtkiBildirimi”ikonunatıklayarakyada080031400

08numaralıyanetkibildirimhattınıarayarakTürkiyeFarmakovijilansMerkezi(TÜFAM)’ne

bildiriniz.Meydanagelenyanetkileri bildirerekkullanma ktaolduğunuzilacıngüvenliliğihakkında

dahafazlabilgiedinilmesinekatkısağlamışolacaksınız.

10/11

5.HUMALOG’uns aklanması

HUMALOG’u çocukların göremeyeceği,erişemeyeceğiyerlerdeveambalajında saklayınız.

İlkkullanımakadarHUMALOG’u(2°C–8°C)arasındabuzdolabındasaklayınız.

Dondurmayınız.Donmuşürünleriçözüpkullanmayınız.KullanmayabaşladığınızHUMALOG’u

odasıcaklığında(30°C’ninaltında)28günekadarsaklayabilirsiniz.Aşırısıcakvedirektgüneş

ışığıaltındabırakmayınız.

Son kullanma tarihiyleuyumluolarakkullanınız.

Ambalajdakiveflakonetiketindekisonkullanma tarihinden sonra HUMALOG’u kullanmayınız.

EğerçözeltirenklenmişyadaiçindekatıparçacıklarvarsaHUMALOG’ukullanmayınız.

Görünümü yalnızsugibiolduğusürecekullanmalısınız.Herenjeksiyondan önceflakonukontrol

ediniz.

Eğerüründeve/veyaambalajındabozukluk fark edersenizHUMALOG’ukullanmayınız.

Çevreyikorumak a macıylakullanmadığınızHUMALOG’uşehirsuyunaveyaçöpeatmayınız.Bu

kon uda eczacınıza danışınız.

RuhsatSahibi:

LillyİlaçTicaretLtdŞti

AcıbademMah. Çeçen Sokak

AkasyaAcıbademKentEtabı

ABlok Kat:3

34660 Üsküdar/İstanbul

Tel:0 216 554 00 00

Faks:0 216 474 71 99

Üretici:

Eli LillyandCompany

Indianapolis–A.B.D.

Bu kullanm atalimatı../../....tarihindeonaylanmıştır.

11/11

Document Outline

21-6-2018

FDA approves automated insulin delivery and monitoring system for use in younger pediatric patients

FDA approves automated insulin delivery and monitoring system for use in younger pediatric patients

FDA approves automated insulin delivery and monitoring system for use in younger pediatric patients

FDA - U.S. Food and Drug Administration

22-10-2018

EU/3/15/1532 (Sirius Regulatory Consulting EU Limited)

EU/3/15/1532 (Sirius Regulatory Consulting EU Limited)

EU/3/15/1532 (Active substance: Insulin human) - Transfer of orphan designation - Commission Decision (2018)6985 of Mon, 22 Oct 2018

Europe -DG Health and Food Safety

27-9-2018

We want to help patients/caregivers know how to use pen needles correctly. FDA received reports of patients using standard pen needles to inject insulin w/o removing the inner needle cover. The cover stopped patients from getting the right amnt of insulin

We want to help patients/caregivers know how to use pen needles correctly. FDA received reports of patients using standard pen needles to inject insulin w/o removing the inner needle cover. The cover stopped patients from getting the right amnt of insulin

We want to help patients/caregivers know how to use pen needles correctly. FDA received reports of patients using standard pen needles to inject insulin w/o removing the inner needle cover. The cover stopped patients from getting the right amnt of insulin https://go.usa.gov/xPWZq  pic.twitter.com/LT9SptJge1

FDA - U.S. Food and Drug Administration

24-9-2018

Ryzodeg (Novo Nordisk A/S)

Ryzodeg (Novo Nordisk A/S)

Ryzodeg (Active substance: Insulin degludec/insulin aspart) - Centralised - Yearly update - Commission Decision (2018)6242 of Mon, 24 Sep 2018

Europe -DG Health and Food Safety

24-9-2018

Tresiba (Novo Nordisk A/S)

Tresiba (Novo Nordisk A/S)

Tresiba (Active substance: Insulin degludec) - Centralised - Yearly update - Commission Decision (2018)6244 of Mon, 24 Sep 2018

Europe -DG Health and Food Safety

28-8-2018

EU/3/18/2061 (Pharma Gateway AB)

EU/3/18/2061 (Pharma Gateway AB)

EU/3/18/2061 (Active substance: Autologous glioma tumour cells treated with antisense molecule directed against the insulin-like growth factor type 1 receptor) - Orphan designation - Commission Decision (2018)5739 of Tue, 28 Aug 2018 European Medicines Agency (EMA) procedure number: EMA/OD/049/18

Europe -DG Health and Food Safety

6-8-2018

Insulin lispro Sanofi (Sanofi-Aventis groupe)

Insulin lispro Sanofi (Sanofi-Aventis groupe)

Insulin lispro Sanofi (Active substance: insulin lispro) - Centralised - Yearly update - Commission Decision (2018)5375 of Mon, 06 Aug 2018

Europe -DG Health and Food Safety

22-6-2018

FDA expands approval of hybrid closed loop system for monitoring and delivering insulin to pediatric patients as young as 7. #cgm #diabetes #pediatrics #fdaapproval #medicaldevice  http://go.usa.gov/xUqgQ pic.twitter.com/wZdrU6tTzf

FDA expands approval of hybrid closed loop system for monitoring and delivering insulin to pediatric patients as young as 7. #cgm #diabetes #pediatrics #fdaapproval #medicaldevice http://go.usa.gov/xUqgQ pic.twitter.com/wZdrU6tTzf

FDA expands approval of hybrid closed loop system for monitoring and delivering insulin to pediatric patients as young as 7. #cgm #diabetes #pediatrics #fdaapproval #medicaldevice http://go.usa.gov/xUqgQ  pic.twitter.com/wZdrU6tTzf

FDA - U.S. Food and Drug Administration

19-6-2018

Insuman (Sanofi-Aventis Deutschland GmbH)

Insuman (Sanofi-Aventis Deutschland GmbH)

Insuman (Active substance: human insulin) - Centralised - Yearly update - Commission Decision (2018)3889 of Tue, 19 Jun 2018

Europe -DG Health and Food Safety

19-6-2018

Lusduna (Merck Sharp and Dohme B.V.)

Lusduna (Merck Sharp and Dohme B.V.)

Lusduna (Active substance: insulin glargine) - Centralised - Transfer Marketing Authorisation Holder - Commission Decision (2018)3918 of Tue, 19 Jun 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/4101/T/6

Europe -DG Health and Food Safety

11-6-2018

Xultophy (Novo Nordisk A/S)

Xultophy (Novo Nordisk A/S)

Xultophy (Active substance: insulin degludec / liraglutide) - Centralised - 2-Monthly update - Commission Decision (2018)3779 of Mon, 11 Jun 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/2647/II/23

Europe -DG Health and Food Safety