HEPATECT

Genel Bilgiler

  • Ticaret Unvanı:
  • HEPATECT CP 50 IU 10 ML FLAKON
  • Reçete türü:
  • Mor
  • İçin kullanmak:
  • İnsanlar
  • İlaç türü:
  • allopatik ilaç

Belgeler

Yerelleştirme

  • Bulunduğu ülkeler::
  • HEPATECT CP 50 IU 10 ML FLAKON
    Türkiye
  • Dil:
  • Türkçe

Terapötik bilgiler

  • Terapötik alanı:
  • hepatit b immünoglobulin

Diğer bilgiler

Durum

  • Kaynak:
  • TİTCK - TÜRKİYE İLAÇ VE TIBBİ CİHAZ KURUMU - Türkiye
  • Yetkilendirme durumu:
  • Aktif
  • Yetkilendirme numarası:
  • 8699535980516
  • Yetkilendirme tarihi:
  • 29-01-2013
  • Son Güncelleme:
  • 25-05-2018

Hasta Bilgi broşürü: Ürün Özellikleri Özeti - kompozisyon, endikasyonlar, yan etkiler, dozaj, etkileşimleri, advers reaksiyonlar, gebelik, laktasyon

KULLANMA TALİMATI

HEPATECTCP500 IU/10 mLIVinfüzyoniçinçözeltiiçerenflakon

Damariçineuygulanır.

Etkinmadde:

Hepatit Binsan immünoglobülini

1 mLinfüzyonlukçözelti:

Farmakolojik olarak aktif madde:

İnsan plazma proteini …………………. 50 mg

İmmünoglobülin Goranı ………………. ≥%96

HBs antikor içeriği…………………….. 50IU

ihtiva eder.

IgG altsınıf dağılımıyaklaşık %59 (IgG1) ,%35(IgG2),%3 (IgG3)ve

%3(IgG4)'tür .

IgA içeriği ≤ 2mg/mL'dir.

Yardımcımaddeler:Glisin, enjeksiyonluk su.

BuilacıkullanmayabaşlamadanöncebuKULLANMATALİMATINIdikkatlice

okuyunuz, çünküsiziniçinönemlibilgileriçermektedir.

Bu kullanma talimatını saklayınız. Daha sonra tekrar okumaya ihtiyaçduyabilirsiniz.

Eğer ilavesorularınız olursa, lütfen doktorunuza veyaeczacınıza danışınız.

Bu ilaçkişisel olaraksizin için reçeteedilmiştir, başkalarına vermeyiniz.

Builacınkullanımısırasındadoktoraveyahastaneyegittiğinizdebuilacıkullandığınızı

söyleyiniz.

Butalimattayazılanlaraaynenuyunuz.İlaçhakkındasizeönerilendozundışındayüksek

veya düşükdoz kullanmayınız.

BuKullanma Talimatında:

1. HEPATECT

CPnedir veneiçinkullanılır?

2. HEPATECT

CP’yikullanmadanöncedikkatedilmesi gerekenler

3. HEPATECT

CPnasılkullanılır?

4. Olasıyanetkiler nelerdir?

5. HEPATECT CP’ninsaklanması

Başlıkları yeralmaktadır.

1. HEPATECTCPnedir veneiçinkullanılır?

Berrakveyahafifbulanıkgörünümdedamariçineuygulanançözeltidir.

İmmünoglobülinlerisimlibirilaçgrubunadahildir.HEPATECTCP,siziHepatitB’ye

karşıkoruyacakhepatitBinsanimmünoglobülinietkinmaddesiniiçerir.HepatitB,

hepatit Bvirüsünün sebep olduğukaraciğeriltihaplanmasıdır.

10 mLçözelti içinde500IU’luk flakon

HEPATECTCPaşağıdabelirtilendurumlardahemenveuzunsürelibağışıklık

(immmünite)sağlamak içinkullanılır:

-HepatitB’denkorunmaiçin(İmmünoproflaksi);hepatitBvirüsüiçerenmalzemelerederi

yoluyla(perkutanöz)yadavücudunboşluklarınıkaplayantabakalardan(permukozal)

maruziyetsonrasıhepatitBenfeksiyonuriskitaşıyanveHepatitBaşısıolmamışveyaaşıları

tamamlanmamışhastalarda,

-Hemodiyaliz(kanın temizlenmesi işlemi)hastalarında, aşılamaetkin olanakadar,

-Hepatit Bvirüsü taşıyan annelerinyenidoğan bebeklerinde,

-Aşılamasonrasındabağışıklık(immün)yanıtıgeliştiremeyenkişiler(hepatitBantikoru

ölçülemeyenler)vesüreklihepatitBenfeksiyonuriskinedeniylesüreklikorumagereken

kişilerdekullanılır.

-HepatitB’yebağlıkaraciğeryetmezliğinde,karaciğernaklinden(transplantasyonundan)

sonrahepatit Bvirüsü enfeksiyonunun tekrarlamasınıönlemedekullanılır.

2. HEPATECTCPkullanmadanöncedikkatedilmesi gerekenler

HEPATECTCPinsanplazmasındanüretilmiştir.Dikkatlidonörseçimivebağışların

taranmasıileetkiliüretimproseslerinedayanarakHEPATECTCP’ninviralhastalık

bulaştırmariskisondereceazdır.TeorikolarakCreutzfeld-Jacobhastalığı(CJD)veya

vCJD’yibulaştırmariskinindesondereceazolduğukabuledilir.HEPATECTCP’nin

kullanımıylailişkilendirilebilecekhiçbirviralhastalıkveyaCJDbulaşmavakası

bildirilmemiştir.

HEPATECTCP’yiaşağıdakidurumlarda KULLANMAYINIZ

Ürünün herhangi bir bileşenine karşıalerjiniz(aşırı duyarlılık)varsa,

İnsanimmünoglobülinekarşıalerjiniz(aşırı duyarlılık)varsa,

HepatitBiçineksiksizşekildeaşılanmışvebağışıklık(immün)yanıtıuygun

bulunmuşsa kullanmayınız.

HEPATECTCP’yiaşağıdakidurumlarda DİKKATLİ KULLANINIZ:

- Eğerkanınızdadüşükantikorseviyelerini(hipo-yada-agammaglobulin-anemi)işareteden

bir durum varsa,

- diğerantikorlarakarşıreaksiyonunuzolduysa(nadirdurumlardaalerjikreaksiyonriskiniz

olabilir)

Kiloluysanız,yaşlıysanız,diyabetseniz,veyakanbasıncınızyüksekse,kanhacminizdüşükse

(hipovolemi),IgAeksikliğinizvarsa,kandamarlarınızlailgilisorunlarınız(vasküler

hastalıklar)varsaveyatrombotikolaylariçinriskliysenizdoktorunuzsiziniçinözelönlemler

alacaktır.

GeçendörthaftaiçerisindeHepatitB’ekarşıaşılanmışisenizdoktorunuzubilgilendiriniz.

HEPATECT CPuygulanacaksa tekrar aşılanmanızgerekebilir.

HEPATECTCPileinfüzyonsüresinceherhangibirreaksiyonoluşmadığındaneminolmak

içindikkatliceizleneceksiniz.DoktorunuzsizeuygunhızdaHEPATECTCPinfüzyonu

yapılmasınısağlayacaktır.

HEPATECTCPinfüzyonusırasındaherhangibirreaksiyonoluşursaderhaldoktorunuza

söyleyiniz.İnfüzyon hızı yavaşlatılabilir veyatamamen durdurulabilir.

HEPATECTCPinsanplazmasındanhazırlanır.İnsankanındanyadaplazmasından

hazırlananilaçlarda,hastalaraenfeksiyonbulaşmasınınönlenmesiönemlidir.Kanbağışçıları

virüslerveenfeksiyonlariçintestedilirler.Buürünlerinüreticilerideayrıcavirüsleri

etkisizleştirmekveyauzaklaştırmakiçinkanyadaplazmayıişlemdengeçirirler.Bunarağmen

insankanıyadaplazmasındanhazırlanantıbbiürünleruygulandığında,enfeksiyonbulaşma

olasılığı tam olarak ortadan kaldırılamayabilir.

Buuyarılar,geçmiştekiherhangibirdönemdedahiolsasiziniçingeçerliyselütfen

doktorunuzadanışınız.

HEPATECTCP’ninyiyecekveiçecekilekullanılması

Uygulamayöntemi açısından diğeryiyecek veiçeceklerleetkileşimiyoktur.

Hamilelik

İlacı kullanmadan öncedoktorunuza veyaeczacınıza danışınız.

Hamileysenizyadaemziriyorsanızdoktorunuzabildiriniz.

HEPATECTCP’ninhamileykenyadaemzirirkenkullanılıpkullanılamayacağınadoktorunuz

verecektir.

HEPATECTCP’nininsanlardahamileliksüresincegüvenliğikontrollüklinikçalışmalarla

kanıtlanmadığından,gebeveemziren anneleredikkatliceuygulanmalıdır.

İmmünoglobülinlerlegerçekleştirilenklinikdeneyler,gebelikesnasında,fetusyadayeni

doğan üzerindezararlı etkileresahip olmadığınıgöstermiştir.

Tedavinizsırasındahamileolduğunuzufarkedersenizhemendoktorunuzaveyaeczacınıza

danışınız.

Emzirme

İlacı kullanmadan öncedoktorunuza veyaeczacınıza danışınız.

Araçvemakinekullanımı

HEPATECTCP’nin araçvemakinekullanımı üzerindehiçbiretkisiyoktur.

HEPATECTCP’niniçeriğindebulunanbazıyardımcımaddelerhakkındaönemli

bilgiler

HEPATECTCP’niniçeriğindebulunanglisin’ekarşıaşırıbirduyarlılığınızyoksa,bu

maddeyebağlıolumsuzbir etkibeklenmez.

Diğerilaçlar ile birliktekullanımı

Zayıflatılmış canlıaşılar

Viralhastalıklariçinuygulanankızamık,kızamıkçık,kabakulakvesuçiçeğigibizayıflatılmış

canlıaşılarınetkisi,immünoglobülinuygulamasındansonra3aysüresinceazalabilir.Bu

ürününuygulanmasındansonra,zayıflatılmışcanlıaşılarınuygulanmasıiçin3ay

beklenmelidir.

İnsanhepatitBimmünoglobulin,zayıflatılmışcanlıaşılarlaaşılamadanüçiladörthaftasonra

uygulanmalıdır.İnsanhepatitBimmünoglobulinileaşılamadahaöncekibirsürede

gerekliyse,insanhepatitBimmünoglobulininsonuygulamasındanüçaysonrayeniden

aşılamayapılmalıdır.

Kan testlerineetkisi

HEPATECTCPkantestlerinietkileyebilir.HEPATECTCPaldıktansonrakantesti

olacaksanızlütfenkanınızıalankişiyeveyadoktorunuzaHEPATECTCPaldığınızı

söyleyiniz.

Eğerreçeteliyadareçetesizherhangibirilacışuandakullanıyorsanızveyasonzamanlarda

kullandınızsa, lütfen doktorunuza veya eczacınızabunlarhakkında bilgiveriniz.

3. HEPATECTCPNasılKullanılır?

Uygunkullanımvedoz/uygulama sıklığı içintalimatlar:

Doktorunuzhastalığınızabağlıolarak ilacınızın dozunu belirleyecek vesizeuygulayacaktır.

Aksi belirtilmediği sürece, aşağıdaki önerilertakip edilmelidir:

HepatitB’yebağlıkaraciğeryetmezliğinde,karaciğernaklinden(transplantasyonu)

sonra hepatit B virüsüenfeksiyonununtekrarlamasını önlemeiçin;

Yetişkinlerde:

Transplantasyongünü,peri-operatif10.000IU,dahasonra7günboyuncahergün2.000IU-

10.000IU(40-200mL),veantikorseviyesininHBVDNAnegatifhastalarda100-150

IU/L’ninüzerindeveHBVDNApozitifhastalarda500IU/L’ninüzerindesürdürülmesiiçin

gerektiği kadarHEPATECTCPinfüzyonugerçekleştirilir.

Hepatit B’den korunma(immünoprofilaksi)için:

-BağışıklığıolmayankişilerdekazaramaruzkalmadurumundaHepatitB’ninönlenmesi:

Maruziyetinyoğunluğunabağlıolarakmaruziyettenhemensonravetercihen24-72saat

içindeen az500IU (10mL).

-Hemodiyalizhastalarındahepatit B’den korunmaiçin(immünoprofilaksi):

Aşılamayıtakibenserumdabelirmeye(serokonversiyon)kadarikiaydabirmaksimum500

IU(10mL)’yekadar 8-12IU (0.16-0.24 mL)/kg.

-HepatitBvirüsütaşıyananneninyenidoğanbebeğindehepatitB’yiönlemekiçindoğumda

veyadoğumdansonramümkünolduğunda:30-100IU(0.6-2mL)/kg.HepatitB

immünoglobülinuygulamasıaşılamayıtakibenserumdabelirmeye(serokonversiyon)kadar

tekrarlanabilir.

Budurumlarıntümünde,hepatitBvirüsünekarşıaşıyapılmasışiddetletavsiyeedilir.Aşının

ilk dozu, insan hepatit Bimmünoglobüliniileaynıgündeancak farklı bir bölgedenyapılabilir.

Aşılamasonrasındabağışıklık(immün)yanıtıgeliştiremeyenkişiler(hepatitBantikoru

ölçülemeyenler)vesüreklikorumagerekenkişilerdeikiaydabiryetişkinlere500IU(10mL)

veçocuklara8IU(0.16mL)/kguygulanabilir;minimumkoruyucuantikortitresienaz10

mIU/mLolarak kabul edilmektedir.

Uygulama yoluvemetodu:

HEPATECTCP,ilk10dakikaboyuncaintravenözyolla,0.1mL/kg/saathızla

uygulanmalıdır.İyitolereedildiğitakdirde,uygulamahızımaksimum1mL/kg/saatolmak

üzereyavaşyavaş arttırılabilir.

Hepatit Bvirüsü taşıyanannelerinyenidoğan bebeklerinde edinilen klinikdeneyimler, 5 ila15

dakikaarasında2mL’likinfüzyonhızındaintravenözHepatectCPuygulamasınıniyitolere

edildiğinigöstermiştir.

Değişikyaş grupları:

Çocuklarda kullanımı:

Pozoloji, Hepatit B’ye bağlı karaciğer yetmezliğinde, karaciğer naklinden

(transplantasyonundan)sonrahepatitBvirüsüenfeksiyonununtekrarlamasınıönlemeiçin

çocuklarda10 000IU/1.73 m 2 ‘edayanarak vücutyüzeyalanınagöreayarlanmalıdır.

Yaşlılarda kullanımı:

Doktorunuzhastalığınızabağlıolarak ilacınızın dozunu belirleyecek vesizeuygulayacaktır.

Özel kullanımdurumları

Böbrekvekaraciğeryetmezliği:

Normalinsanimmünoglobüliniyle

serumkreatininseviyelerindeartışve/veyaanibaşlangıçlı

böbrekyetmezliği(akutrenalyetmezlik)gözlenmiştir.İnfüzyonhızıyavaşlatılmalıveya

durdurulmalıdır.

EğerHEPATECTCP’ninetkisininçokgüçlüveyazayıfolduğunadairbirizleniminizvarise,

doktorunuz veyaeczacınız ilekonuşunuz.

Kullanmanız gerekendendahafazlaHEPATECTCPkullandıysanız:

HEPATECTCP’denkullanmanızgerekendenfazlasınıkullanmışsanızbirdoktorveyaeczacı

ilekonuşunuz.

HEPATECTCP’yikullanmayı unutursanız:

Bu durumda doktorunuzbaşka bir dozun gerekliolup olmadığına karar verecektir.

Unutulan dozları dengelemekiçin çift dozuygulamayınız.

HEPATECTCPiletedavi sonlandırıldığında oluşabileceketkiler:

İlacın kesilmesiyleilişkilendirilebilecek herhangibir etkigörülmez.

4. Olasıyanetkilernelerdir?

Tümilaçlargibi,HEPATECTCP‘niniçeriğindebulunanmaddelereduyarlıolankişilerde

yanetkilerolabilir.

Yan etkileraşağıdaki kategorilerdegösterildiği şekildesıralanmıştır:

Çokyaygın :10 hastanın en az1´indegörülebilir.

Yaygın :10 hastanın birinden az, fakat 100 hastanın birinden fazla görülebilir.

Yaygınolmayan:100hastanınbirindenaz,fakat1.000hastanınbirindeveyabirindenfazla

görülebilir.

Seyrek : 1.000hastanın birindenaz, fakat 10.000 hastanınbirindeveyabirindenfazla

görülebilir.

Çok seyrek : 10.000 hastanın birinden azgörülebilir.

Bilinmiyor : Eldeki verilerden hareketletahmin edilemiyor.

Seyrekolarak aşağıdakiler meydanagelebilir:

Titreme

Baş ağrısı

Ateş

Kusma

Halsizlik

Midebulantısı

Kan basıncı düşüklüğü

Aşırı duyarlılık

Kızarıklık(eritem), kaşıntıgibideri reaksiyonları

Kalp atımının hızlanması(Taşikardi)

Çokseyrek, aşağıdakilermeydanagelebilir:

Ciddialerjik reaksiyonlar(Anafilaktik şok)

Eklem ağrısı(Artralji)

Normal insan immünoglobüliniyleaşağıdakireaksiyonlargözlenmiştir:

-beyninyüzeyindeki enfeksiyözolmayan iltihap (geri dönüşlüaseptik menenjitvakaları),

-kırmızıkanhücresayısındadüşüş(izolehemolitikanemi/hemolizvakaları)veender

geçicideri(kutanöz)reaksiyonlarıgözlenmiştir.

-Serumkreatininseviyelerindeartışve/veyaanibaşlangıçlıböbrekyetmezliği(akutrenal

yetmezlik)gözlenmiştir.

-Yaşlılarda,beyneyadakalbeyetersizkangitmesi(serebralyadakardiyakiskemi)

belirtilerigörülenhastalarda,aşırıkiloluhastalardaveşiddetlikanhacmindeazalma

(hipovolemi)görülen hastalardatromboembolikolaylar bildirilmiştir.

Yan etkilermeydanagelirseinfüzyon hızıyavaşlatılmalıveyadurdurulmalıdır.

Eğerbukullanmatalimatındabahsigeçmeyenherhangibiryanetkiilekarşılaşırsanız

doktorunuzu veyaeczacınızıbilgilendiriniz.

5. HEPATECTCP’ninsaklanması

HEPATECTCP’yiçocuklarıngöremeyeceği,erişemeyeceğiyerlerdeveambalajında

saklayınız.

HEPATECTCP,+2ºCila+8ºC’desaklanmalıdır.Dondurmayınız.Donmuşürünleriçözüp

kullanmayınız.

Ürünü, dışkarton paketiiçindesaklayınız.

Çözelti, kapak açıldıktan hemen sonrauygulanmalıdır.

Sonkullanma tarihiyleuyumluolarak kullanınız

Ambalajdaki /Kartondaki sonkullanma tarihinden sonraHEPATECTCP’yikullanmayınız.

Eğer ürün ve/veyaambalajında bozukluklar fark edersenizHEPATECTCP’yikullanmayınız.

ÇevreyikorumakamacıylakullanmadığınızHEPATECTCP’yişehirsuyunaveyaçöpe

atmayınız. Bu konuda eczacınıza danışınız.

RuhsatSahibi:KansukLaboratuarıSan.Tic.A.Ş.BeşyolMahallesiEskiLondraAsfaltıNo.

4 Sefaköy/İSTANBUL

Tel:0 212 592 15 76

Faks:0212 580 37 72

Üretimyeri:Biotest PharmaGmbH,Landsteinerstrasse 5, D-63303Dreieich, Almanya

Tel.:(49)6103 801 0

Faks: (49)6103 801 150

Bu kullanmatalimatı01/07/2013tarihinde onaylanmıştır.

-----------------------------------------------------------------------------------------------------------------

AŞAĞIDAKİBİLGİLERBUİLACIUYGULAYACAKSAĞLIKPERSONELİ

İÇİNDİR:

Özel kullanımuyarıları ve önlemleri

TromboembolikkomplikasyonlarnormalIVIgkullanımıileilişkilendirilmiştir.Buyüzden,

özellikletrombotik risk faktörü olanhastalaradikkat edilmesi önerilmektedir.

Hastalaranti-HBsantikor seviyeleri için düzenliolarak izlenmelidir.

İnfüzyonhızınabağlıolarakbazıciddiyanetkileroluşabilir."uygulamaşekli"başlığıaltında

önerileninfüzyonhızıtakipedilmelidir.Hastalar,infüzyonsüresinceolasısemptomlariçin

izlenmelivegözlemaltındatutulmalıdır.İnfüzyonlailgiliyanetkimeydanagelirseinfüzyon

hızı azaltılmalı veyainfüzyondurdurulmalıdır.

HEPATECTCCPazmiktardaIgAiçermektedir.IgAseviyesiyetersizolankişilerdeIgA

antikorugelişmepotansiyelibulunurvebukişilerdeIgAiçerenkanbileşiklerinin

uygulanmasınıtakibenanafilaktikreaksiyonlargörülebilir.DolayısıyladoktorHEPATECT

CPtedavisininfaydalarınıaşırıhassasiyetreaksiyonlarınınriskpotansiyelinekarşı

değerlendirmelidir.

Greftenfeksiyonununtekrarlanmasınıönleyicitedavisırasındakiçoknadirintolerans

reaksiyonları, uygulamalar arasındaki sürenin artmasınabağlıolabilir.

Hastalara,mümkünolanherdurumda,HEPATECTCPuygulamasınınardındanürününisim

veseri numarasınıkayıtetmeleri önerilir.

Alerjikveyaanafilaktiktiptekireaksiyonlardanşüpheedildiğinde,enjeksiyonhemen

kesilmelidir. Şok durumundastandart tıbbi şok tedavisiuygulanmalıdır.

Geçimsizlikler

Bu tıbbi ürün, diğer tıbbiürünlerle karıştırılmamalıdır.

ElektrolitkonsantrasyonuyadapHdeğerindekideğişikliklerproteinlerinçökelmesi

(presipitasyonu)veyadoğalyapısınınbozulması(denatürizasyonu)ilesonuçlanacağından,

HEPATECTCPçözeltisinediğerbir preparat ilaveedilmemelidir.

Beşeri tıbbi üründenarta kalanmaddelerinimhası ve diğerözel önlemler

Kullanılmayanürünyadaatıkmalzemeler,“TıbbiÜrünlerinKontrolüYönetmeliği”ve

“Ambalaj veAmbalaj Atıklarının Kontrolü Yönetmeliği ”neuygunolarak imha edilmelidir.

EtiketvedışambalajüzerindeyazansonkullanmatarihindensonraHEPATECTCP’yi

kullanmayınız.

Ürün, kullanmadan önceodasıcaklığınagetirilmelidir.

Çözeltiberrakyadahafifopalesanolmalıdır.Bulanıkyadatortularoluşmuşçözeltileri

kullanmayınız.

Ürün açıldıktan sonrahemen kullanılmalıdır.

28-11-2018

Minister Bruno Bruins bereikt akkoord over openbare verlaging van prijzen voor geneesmiddelen tegen hepatitis C

Minister Bruno Bruins bereikt akkoord over openbare verlaging van prijzen voor geneesmiddelen tegen hepatitis C

Minister Bruno Bruins voor Medische Zorg heeft besloten acht nieuwe medicijnen tegen chronische hepatitis C te blijven vergoeden. Tot nu toe golden vertrouwelijke prijsafspraken voor deze middelen, maar die zijn vanaf 1 januari 2019 niet meer nodig. Twee leveranciers hebben gehoor gegeven aan een oproep van de minister voor een openbare prijsverlaging.

Netherlands - Ministerie van Volksgezondheid, Welzijn en Sport

29-6-2018

Nieuwe behandeling tegen hepatitis C in het basispakket

Nieuwe behandeling tegen hepatitis C in het basispakket

Een nieuwe behandeling tegen chronische hepatitis C met het geneesmiddel Vosevi wordt vanaf 1 juli 2018 vergoed vanuit het basispakket. Dat heeft minister Bruno Bruins (Medische Zorg) besloten nadat hij met de fabrikant onderhandeld heeft over de prijs van het nieuwe middel. Vosevi kan worden ingezet bij alle patiënten met een chronische hepatitis C infectie. Met de opname van Vosevi zijn nu alle geneesmiddelen voor hepatitis C patiënten in Nederland beschikbaar vanuit het basispakket .

Netherlands - Ministerie van Volksgezondheid, Welzijn en Sport

13-9-2018

 European Medicines Agency stakeholder interaction on the development of medicinal products for chronic non-infectious liver diseases (PBC, PSC, NASH), European Medicines Agency, London, UK, From: 03-Dec-2018, To: 03-Dec-2018

European Medicines Agency stakeholder interaction on the development of medicinal products for chronic non-infectious liver diseases (PBC, PSC, NASH), European Medicines Agency, London, UK, From: 03-Dec-2018, To: 03-Dec-2018

This workshop on the development of medicines for chronic non-infectious liver diseases, including primary biliary cholangitis, primary sclerosing cholangitis and nonalcoholic steatohepatitis, provides a platform for discussion on appropriate endpoints including validation of surrogate endpoints/biomarkers, suitable study populations, potentially adequate trial designs and the specific challenges with paediatric medicine development. The workshop will support the drafting of a reflection paper on regul...

Europe - EMA - European Medicines Agency

4-6-2018

EU/3/05/334 (Florence Porte ThomE)

EU/3/05/334 (Florence Porte ThomE)

EU/3/05/334 (Active substance: Human immunoglobulin G1 constant region - human ectodysplasin-A1 receptor-binding domain fusion protein) - Transfer of orphan designation - Commission Decision (2018)3629 of Mon, 04 Jun 2018 European Medicines Agency (EMA) procedure number: EMA/OD/064/05/T/03

Europe -DG Health and Food Safety

29-5-2018

EU/3/18/2022 (Hanmi Europe Limited)

EU/3/18/2022 (Hanmi Europe Limited)

EU/3/18/2022 (Active substance: Glucagon analogue linked to a human immunoglobulin Fc fragment) - Orphan designation - Commission Decision (2018)3389 of Tue, 29 May 2018 European Medicines Agency (EMA) procedure number: EMA/OD/257/17

Europe -DG Health and Food Safety