ELLEACNELLE

Genel Bilgiler

  • Ticaret Unvanı:
  • ELLEACNELLE 21 DRAJE
  • Reçete türü:
  • Normal
  • İçin kullanmak:
  • İnsanlar
  • İlaç türü:
  • allopatik ilaç

Belgeler

Yerelleştirme

  • Bulunduğu ülkeler::
  • ELLEACNELLE 21 DRAJE
    Türkiye
  • Dil:
  • Türkçe

Terapötik bilgiler

  • Terapötik alanı:
  • siproteron ve östrojen

Diğer bilgiler

Durum

  • Kaynak:
  • TİTCK - TÜRKİYE İLAÇ VE TIBBİ CİHAZ KURUMU - Türkiye
  • Yetkilendirme durumu:
  • Aktif
  • Yetkilendirme numarası:
  • 8699769120016
  • Yetkilendirme tarihi:
  • 29-01-2013
  • Son Güncelleme:
  • 24-05-2018

Hasta Bilgi broşürü: Ürün Özellikleri Özeti - kompozisyon, endikasyonlar, yan etkiler, dozaj, etkileşimleri, advers reaksiyonlar, gebelik, laktasyon

1/17

KULLANMATALİMATI

ELLEACNELLEdraje

Ağızdanalınır.

Etkinmaddeler:Herdraje,2mgsiproteronasetatve0.035 mgetinilestradioliçerir.

Yardımcımadde(ler):Laktozmonohidrat,mısırnişastası,povidon K25,magnezyum

stearat,talk,sukroz,kalsiyumkarbonat,makrogol6000,titanyumdioksit(E171),povidon

K90,gliserol %85,montan glikolik mum

Builaç ekizlemeye tabidir.Buüçgenyenigüvenli likbilgisininhızlıolarak

belirlenmesinisağlayacaktır.Meydanagelenherhangibiryanetkiyiraporlayarakyardımcı

olabilirsiniz.Yanetkilerinnasılraporlanacağınıöğrenmekiçin4.Bölümünsonuna

bakabilirsiniz.

BuilacıkullanmayabaşlamadanöncebuKULLANMATALİMATINIdikkatlice

okuyunuz,çünkü sizin için önemli bilgileriçermektedir.

Bu kullanma talimatınısaklayınız. Daha sonra tekrarokumaya ihtiyaçduyabilirsiniz.

Eğerilavesorularınızolursa, lütfen doktorunuza veyaeczacınıza danışınız.

Bu ilaçkişiselolaraksizin için reçeteedilmiştir, başkalarınavermeyiniz.

Builacınkullanımısırasında,doktoraveyahastaneyegittiğinizdedoktorunuzabuilacı

kullandığınızısöyleyiniz.

Butalimattayazılanlaraaynenuyunuz.İlaçhakkındasizeönerilendozundışında

yüksek veya düşükdozkullanmayınız.

BuKulla nma Talimatında:

1.ELLEACNELLE nedirveneiçinkullanılır?

2.ELLEACNELLE’ikullanmadanöncedikkatedilmesigerekenler

3.ELLEACNELLEn asılkullanılır?

4. Olasıyanetkiler nelerdir?

5.ELLEACNELLE’ins aklanması

Başlıklarıyeralmaktadır.

1.ELLEACNELLE nedirveneiçinkullanılır?

ELLEACNELLE, 21 drajelik ambalajlardabulunurvedrajelerbeyazrenktedir. Her

draje etkin maddeolarak2 mgsiproteronasetatve0,035 mgetinilestradioliçerir.

ELLEACNELLE, östrojen(kadıncinsiyethormonlarındanbiri)veantiandrojenik

(erkekcinsiyethormonlarınınbazıdoğaletkilerinigideren)aktiviteyesahip

progesteron (kadın cinsiyethormonlarından biri)hormonu içerir.

ELLEACNELLEdoğurganlık çağındakikadınlardaaşırıyağlanmailebirlikteveyatek

başınaortadereceliilaşiddetliaknetedavisive/veyaaşırıkıllanmagibicilt

rahatsızlıklarınıntedavisindekullanılır.Doğumkontrolözelliklerinedeniyle,yalnızca

doktorunuzhormonalkontraseptif(doğumkontrolilacı)tedavisininuygunolduğunu

2/17

düşündüğütakdirdereçeteedilebilir.ELLEACNELLE,aknetedavisindeyalnızca

cildeuygulananveyatümvücudu etkileyen antibiyotik tedav isininbaşarısızolduğu

durumlardakullanılmalıdır.CiltleilgilibirtedaviiçinELLEACNELLE

kullanıyorsanız, aynı zamanda farklı bir hormonal kontraseptif

kullanmamalısınız.

CiltsorununuzdüzeldiğindeveELLEACNELLEkullanmayıbıraktığınızdadahaönce

ercih ettiğiniz/asılkontrasepsiyon(doğumkontrol)yönteminizegeridönmelisiniz.

Doğumkontrolhapıgibietkigösterdiğindendiğerhormonaldoğumkontrolhaplarla

birliktekullanılmamalıdır.

Ciltsorunlarınıntedavisi

Androjenlerderidekılgelişiminiveyağbezleriniuyaranhormonlardır.Çokfazlaandrojen

üretimiolduğundaveyaandrojenetkisineduyarlıysanız,yağbezleriçokfazlasebum

üretebilir.Budurumyağbezleriniblokeedebilirveböyleceenfeksiyongelişebilir,iltihaplı

aknenoktalarıoluşabilir.ELLEACNELLEandrojenlerincildinizi etkilemesini durdururve

üretilen androjen miktarınıazaltır.

Doğumkontrolü

ELLEACNELLE21günlükbirdoğumkontrolhapıdır;21günboyuncahergünbirdraje

alınırvesonraki7gün boyuncahiçdrajealınmaz.

LEACNELLEKlamidya(cinselyollabulaşanbakteri)veyaHIVenfeksiyonu(AIDS)ve

diğercinselyollageçenhastalıklarakarşıkorumasağlamaz.Butiphastalıklarınbulaşması

ancak kondomlarileönlenebilir.

ELLEACNELLE'in gebeliğiönlemesiiçinbelirtildiğişekildealınmasıgerekir.

2.ELLEACNELLE’ikullanmadan öncedikkatedilmesigerekenler

ELLEACNELLE’i aşağıdakidurumlardaKULLANMAYINIZ

Herhangibirtıbbisorununuzveyahastalığınızvarsadoktorunuzasöyleyiniz.

Aşağıdakidurumlardanherhangi biri siziniçingeçerliyseELLEACNELLEkullanmaya

başlamadanöncebunudoktorunuzabildiriniz.Budurumdadoktorunuzfarklıbirtedavi

almanızıtavsiyeedebilir:

Eğer;

Eşzamanlıolarak başkabirhormonaldoğumkontrolyöntemikullanıyorsanız,

Gebeisenizveyagebeolduğunuzdan şüpheleniyorsanız,

Emziriyorsanız,

Meme kanseriisenizveya öncedenmeme kanserinizvarsa,

Bacağınızda(tromboz),akciğerlerinizde(pulmonerembolizm)veyavücudunuzun

diğerbirbölgesindekanpıhtısıvarsa(veyaöncedenolduysa),

Gelecektekalpkrizigöstergesiolabilecekbirhastalığınız(örn.göğüsteşiddetliağrıya

neden olan anjinapektoris)yadamini-inme (geçiciiskemikatak)varsa (veyaönceden

olduysa),

Serebravaskülerkazabulgusu veyaöyküsü varsa(Kalp kriziveyainmevarsaveya

dahaöncedengeçirdiyseniz),

Atardamarlardakanpıhtısıoluşmariskiniartırabilecekbirhastalığınızvarsa.Bu

durum, aşağıdakihastalıklariçin geçerlidir:

3/17

- Kan damarlarınızıetkileyen diyabet(şekerhastalığı)

-Çokyüksek tansiyon

- Kanınızdakiyağdüzeyinin çokyüksek olması(kolesterolveyatrigliserid)

Toplardamarveyaatardamarlarınızdakanpıhtılaşmasıileilgilikalıtsalveyaedinilmiş

yatkınlığınızvarsa(örn.AktifleşmişproteinC(APC)direnci,antitrombin-III

eksikliği,proteinCeksikliği,proteinSeksikliği,Hiperhomosisteinemive

antifosfolipid antikorları(antikardiyolipin antikorları, lupusantikoagülanı)),

Görmebozukluklarıilebirliktemigreninizvarsa(veyaönceden olduysa),

Herhangibirzamandaşiddetlikaraciğerhastalığınızolduysavedoktorunuzkaraciğer

testlerinizin henüznormaledönmediğinisöylediyse,

Karaciğertümörü varlığıyadahikayenizvarsa,

İlacın içerdiğimaddelerden birinekarşıalerjinizvarsa.

Bukoşullardanherhangibiriilacıilkkullandığınızdabaşınızagelirsederhalkullanmayı

bırakın vedoktorunuzadanışınız.

ELLEACNELLEerkeklerdekullanılmaz.

ELLEACNELLE’iaşağıdakidurumlardaDİKKATLİKULLANINIZ

Kullanımsüresi

Belirtilerinhafiflemesinekadargeçensüreenazüçaydır.Tedaviyisürdürmeihtiyacı,tedavi

eden doktortarafından düzenliolarak değerlendirilmelidir.

KullanmayabaşlamadanönceveyakullanmadevametmekararıverirkenELLEACNELLE

kullanımınınfaydalarınıverisklerinianlamanızönemlidir.ELLEACNELLEçoğusağlıklı

kadın için uygun olsadaherkesiçin uygun birseçenek olmayabilir.

Bukullanmatalimatındabelirtilenhastalıklardanveyariskfaktörlerindenherhangibirine

sahipseniz,doktorunuzu bilgilendirin.

ELLEACNELLEkullanmaya başlamadanöncedikkatedilmesigerekenler

ELLEACNELLE’ialmayabaşlamadanöncedoktorunuzsizinveyakınakrabalarınızınsağlık

geçmişihakkındabazısorularsoracaktır.Doktorunuzaynızamandatansiyonunuzuölçecektir

vegebeolmaolasılığınızıkontroledecektir.Mememuayenesigibibaşkakontrollerde

yapılmasıgerekebilir,ancakbunlaryalnızcagerekliyseveözelbirtakımdurumlarsöz

konusuylayapılır.

ELLEACNELLEkullanırken

DoktorunuzgenelliklediğerbirELLEACNELLEreçetesigerektiğindedüzenli

kontrolleryaptırmanızıisteyecektir.

D üzenliolarakservikalsmeartesti(rahimağzıkansertaramatesti)yaptırmaya

gitmelisiniz.

Heraydeğişiklikolupolmadığınıanlamakiçinmemeuçlarınızıvememelerinizi

kontrolediniz,cildinizdeçukurlaşmaveyayumrugibituhafbirşeyfarkettiğiniz

takdirdedoktorunuzu söyleyiniz.

4/17

Kantetkikiyapılmasıgerektiğindedoktorunuzaveyalaboratuvarpersoneline

ELLEACNELLEkullandığınızıbildiriniz,çünkübutipilaçlarbazıtestlerinsonucunu

etkileyebilmektedir.

Birameliyatgeçirmenizgerektiğinde,doktorunuzunbuhapıkullandığınızıbilmesi

gerekir.Operasyondan4ila6haftakadarönceELLEACNELLEkullanımını

bırakmanızgerekebilir.Bununnedenikanpıhtısıriskiniazaltmaktır.Doktorunuz

ELLEACNELLE’iyenidennezamankullanmayabaşlayabileceğinizisize

söyleyecektir.

ELLEACNELLEkullanmayıbırakmanızgerekirse,eğerdoğumkontrolüiçin

ELLEACNELLE'e güveniyoriseniz,diğerbirdoğumkontrolyöntemi(örn.kondom)

kullanmayıunutmayınız.

Doktorunuzadanışmanızıgerektirendurumlar

Kanpıhtısıylailgiliolasıbirbelirtiylekarşılaşırsanız,ilacıbırakınızvederhal

doktorunuzlagörüşünüz.Bubelirtiler“Kanpıhtıları(Tromboz)”başlığıaltındave“4.

OlasıYanEtkilerNelerdir?” bölümündeaçıklanmaktadır.

ELLEACNELLEaynızamandadoğumkontrolhapıolarak daetkigösterir. Sizin ve

doktorunuzunnormaldeoralhormonaldoğumkontrolhaplarınıngüvenlikullanımıiçin

geçerliolan tümhususlarıdikkatealmasıgerekir.

Kan pıhtıları(Tromboz)

ELLEACNELLEkanpıhtısıoluşumriskiniziartırabilir.ELLEACNELLEkullanıyorolmanız

kanpıhtısıgelişmeriskiniELLEACNELLEveyaherhangibirdoğumkontrolhapı

kullanmayankadınlarakıyaslayalnızcahafiforandaartırabilir.Herzamantamiyileşme

sağlanamayabilirveolguların%1-2'si ölümcül olabilir.

Toplardamari çikan pıhtıları

Birtoplardamardakanpıhtısıgelişmesi(venöztrombozolarakbilinir)damarıntıkanmasına

nedenolabilir.Budurumbacak,akciğer(akciğerembolisi)veyaherhangibirdiğerorgandaki

birdamarda meydanagelebilir.

Kombinehapkullanımı,kadınlardabutippıhtıgelişmesineilişkinriskiherhangibirkombine

hapkullanmayankadınlarakıyaslaartırır.Birdamariçindekanpıhtısıgelişmeriskininen

yüksekolduğudönemhapınkullanılmayabaşlandığıilkyıldır.Sözkonusurisk,gebelik

sırasındakan pıhtısıgelişmesineilişkin risk kadaryüksek değildir.

Kan pıhtısıgelişmesineilişkin risk ELLEACNELLEkullandığınızdayalnızcabirazartar.

ELLEACNELLEkullanmayanvedoğumkontrolhapıalmayanvegebeolmayan

100.000 kadındanyaklaşık 5 ila10'undabiryıliçindekan pıhtısıoluşacaktır.

ELLEACNELLEkullananveyadoğumkontrolhapıalan100.000kadındanyaklaşık

ındabiryıliçindekanpıhtısıoluşacaktır.

Gebeolan 100.000 kadındanyaklaşık 60'ındabiryıliçerisindekan pıhtısıoluşacaktır.

Kombinehapkullananlardadamariçindekanpıhtısıoluşmasınailişkinriskaşağıdakilerle

birlikte daha da artar:

İlerleyenyaş,

Sigarakullanımı,

5/17

35yaşından büyükseniz, ELLEACNELLEgibibirdoğumkontrolhapıkullanırken

sigarayıbırakmanızönemletavsiyeedilir

Yakınbirakrabanızdagençyaştabacak,akciğerveyadiğerbirorgandakanpıhtısı

olduysa,

Aşırıkiloluysanız,

Operasyongeçirmenizgerektiğindeveyayaralanmayadahastalıknedeniyle

ayaklarınızıuzun süreyerebasmayacaksanızveyabacağınızalçıdaysa,

Polikistik oversendromunuz(yumurtalıklardaoluşan kistler)varsa,

Yakın zamandadoğumyaptıysanız,

Sistemiklupuseritematozus(eklemağrılarıvederidöküntülerinesebepolanbir

hastalık),CrohnHastalığı(kronikiltihabibağırsakhastalığı)veyaülseratifkolit(kalın

barsağın iltihaplıbirhastalığı)gibibirtakımnadirtıbbisorunlarınızvarsa,

Orak hücrelianemi(kalıtsalkan hastalığı)hastasıysanız.

Bunlardan herhangibirisizin için geçerliysetedavinizin kesilmesigerekebileceğinden,

ELLEACNELLEkullandığınızıdoktorunuzasöylemenizönemlidir.Doktorunuzameliyattan

veya hareketsizkalmanızdanhaftalarönceELLEACNELLEkullanmayıbırakmanızı

söyleyebilir. DoktorunuzayağakalktığınızdanezamanyenidenELLEACNELLEkullanmaya

başlayabileceğinizide söyleyecektir.

Atardamariçikan pıhtıları

Biratardamariçindekanpıhtısıoluşmasıciddisorunlarayolaçabilir.Örneğin,kalpteki

atardamarlardanbirindekanpıhtısıoluşmasıkalpkrizineyolaçabilir,bununbeyindeolması

inmeye nedenolabilir.

Kombinehapkullanımıatardamarlardapıhtıoluşmasınailişkinriskteartışla

ilişkilendirilmiştir. Bu risk aşağıdakidurumlardadahadaartar:

İlerleyenyaş,

Sigarakullanımı.35yaşındanbüyükseniz,ELLEACNELLEgibibirhormonaldoğum

kontrolh apıkullanırkensigarayıbırakmanızönemletavsiyeedilir

Aşırıkiloluysanız,

Yüksek tansiyonunuzvarsa,

Yakın birakrabanızdagençyaştakalp kriziveyainmegeliştiyse,

Kanınızdakiyağdüzeyiyüksekse(kolesterolveyatrigliseridler),

Migreninizvarsa,

K alp rahatsızlığınızvarsa(kapak hastalığı, ritimbozukluğu),

Polikistik oversendromunuz(yumurtalıklardaoluşan kistler)varsa,

Diyabetiniz(şekerhastalığı)varsa,

Sistemiklupuseritematozus(eklemağrılarıvederidöküntülerinesebepolanbir

hastalık)gibibirtakımnadirtıbbisorunlarınızvarsa,

Orak hücrelianemi(kalıtsalkan hastalığı)hastasıysanız.

Aşağıdakilergibikanpıhtısıylailgiliolasıbirbelirtiylekarşılaşırsanız,ilacıkullanmayı

bırakın vederhaldoktorunuzlagörüşünüz:

Alışılmadıkaniöksürük,

Solkolayayılanyadayayılmayan şiddetligöğüsağrısı,

Soluksuzluk,

Şiddetlenen migrenyadaalışılmadık, uzun süren,şiddetlibaşağrısı,

6/17

Kısmiveyatamkörlükyadaçiftgörme,

Peltek konuşmaveyakonuşmabozukluğu,

Duyma, kokualma, tat almaduyularındaanideğişiklikler,

Başdönmesiveyabayılma,

Vücudun herhangibirbölgesindegüçsüzlük veyauyuşma,

Karın bölgesindeşiddetliağrı,

Bacaklardan birindeşiddetliağrıveyaşişme.

Kanpıhtısıoluştuktansonra,herzamantamiyileşmeolmayabilir.Nadirenkalıcıciddiyeti

kaybıortayaçıkabilirveyakan pıhtısıölümcülolabilir.

Doğumdanhemensonrakadınlardakanpıhtısıriskiartar,bunedenledoğumdannekadar

sonraELLEACNELLE kullanmayabaşlayabileceğinizidoktorunuzadanışmalısınız.

Şiddetlidepresyon,şiddetlialerjikreaksiyon,kalıtsalanjiyoödemde(vücutbölgelerinde

şişme)kötüleşme,memekanseriveyarahimağzıkanseriyleilgilibelirtileryadaciddi

karaciğer(belirtiveişaretler“4.OlasıYanEtkilerNelerdir?”bölümündeaçıklanmıştır.)

sorunlarıylakarşılaşmanızhalindederhaldoktorunuzadanışmalısınız.

ELLEACNELLE vekanser

Yüksek dozkombinedoğumkontrolhaplarıuzun süreylekullanıldığındayumurtalık verahim

kanseririskiniazaltıyorolmaklabirlikte,ELLEACNELLEgibidüşükdozöstrojen

progesteroniçerendoğumkontrolhaplarınındaaynıkoruyucuetkilerigösteripgöstermediği

tamolarakbilinmemektedir.Bunakarşın,ELLEACNELLEkullanımırahimağzıkanserine

ilişkinriskihafifderecedeartırıyorgibigörünmektedir;ancak bunun nedeni

ELLEACNELLE'denziyadecinselilişkidekondomkullanılmamasıolabilir.Tümkadınlar

düzenliolaraksmeartestiyaptırmalıdır.

Memekanseriisenizveyaöncedenmemekanseritanısıaldıysanız,ELLEACNELLEyada

diğerdoğumkontrolhaplarınıkullanmamalısınız,zirabunlarmemekanseririskinihafif

ölçüdeartırmaktadır.BuriskELLEACNELLEkullanmayadevamettikçeartarancak

bıraktıktansonrayaklaşık10yıliçerisindenormaledöner.Memekanseri40yaşaltı

kadınlardanadirolduğundan,ELLEACNELLEkullananlardaveyayakınzamandakullanmış

olanlardafazlamemekanseriolgusuazdır. Örneğin:

HiçELLEACNELLEkullanmamışolan10.000kadının35yaşınagelenekadarmeme

kanseriolmaihtimaliyaklaşık16'dır.

Yirmiliyaşlarınbaşında5yılsüreyleELLEACNELLEveyadoğumkontrolhapı

kullanmışolan10.000kadınınm35yaşınagelenekadarmemekanseriolmaihtimali

yaklaşık 17-18'dir.

HiçELLEACNELLEkullanmamışolan10.000kadının45yaşınagelenekadarmeme

kanseriolmaihtimaliyaklaşık 100'dür.

Otuzluyaşlarınbaşında5yılsüreyleELLEACNELLEveyadoğumkontrolhapı

kullanmamışolan10.000kadınının45yaşınagelenekadarmemekanseriolma

ihtimaliyaklaşık 110'dur.

Aşağıdakidurumlardamemekanserineilişkin risk dahayüksektir:

Yakın birakrabanızda(anne, kızkardeşveyabüyükanne)memekanseriöyküsü

7/17

Ciddiderecedeaşırıkilolu olma

Memedeçukurlaşma,memeuçlarındadeğişikliklerveyagörünenyadahissedilebilenyumru

gibiherhangibirdeğişiklik fark edersenizen kısasüredebirdoktorabaşvurun.

ELLEACNELLEkullanımısarılıkvekanserolmayankaraciğertümörlerigibi

karaciğerhastalıklarıiledeilişkilendirilmiştirancakbudurumnadirdir.Çoknadir

olarak;ELLEACNELLEuzunsürekullanankadınlardabazıkaraciğerkanseritipleri

ilede ilişkilendirilmiştir.

Midenizdeşiddetliağrıveyacildinizdeyadagözlerinizdesararma(sarılık)meydanagelirse

en kısasüredebirdoktorabaşvurunuz. ELLEACNELLEkullanmayıbırakmanızgerekebilir.

Gebelik sırasındaveyaöncekidoğumkontrolhapıkullanımıylakötüleşebilen durumlar:

AşağıdakidurumlarınhemgebelikhemdebirKOKveyaELLEACNELLEgibi

östrojen/progesteronkombinasyonununkullanımıilemeydanageldiğiveyakötüleştiği

bildirilmiştir.Aşağıdakilerinherhangibirininkullanımsırasındameydana gelmesihalinde,

ELLEACNELLE’ibırakınız:

Kolestazileilişkilisarılıkve/veyakaşıntı(pruritus)

Safrakesesitaşı

Sistemiklupuseritematozus(eklemağrılarıvederidöküntülerinesebepolanbir

hastalık)

Herpesgestationis(gebelik sırasındasutoplamayabenzerdöküntü)

Otosklerozabağlıişitmekaybı

Orak hücrelianemi(kalıtsalkan hastalığı)

Renaldisfonksiyon (böbrek işlev bozukluğu)

Herediteranjiyoödem(vücutbölgelerindeşişme)

TekbirkadındagebeliksırasındaveyaöncekiKOKyadaELLEACNELLEkullanımı

sırasındakötüleşmegösterdiğibildirilen hertürlü diğerdurum.

ELLEACNELLEbazıhastalıklarınkötüleşmesinenedenolabilir.

Aşağıdasıralanan durumların birkısmıELLEACNELLEkullanımıylakötüleşebilir. Başkabir

deyişle,siziniçindahaazuygunolduğuanlamınagelebilir.ELLEACNELLE'iyinede

kullanabilirsinizancakdahadikkatliolmanızvedahasıksağlıkkontrolündengeçmeniz

gerekir.

Sizdeveyaailenizdeyüksektansiyongibikalpyadadolaşımlailgilisorun

varsa/olduysa

Sizde veya ailenizdekanpıhtılaşmasıileilgilisorunvarsa/olduysa

Migreninizvarsa/olduysa

Günümüzdeveyageçmiştedepresyonyaşıyorsanız/yaşadıysanız

Aşırıkilolu (obez)iseniz

Porfiriadıverilenkalıtsalhastalığınızvarsa

Diyabethastasıysanız

Pankreasiltihab ınız(pankreatit)varsaveyapankreatitgelişmesineilişkinriski

artırabileceğiiçin,sizdeyadaailenizdekandakiyağdüzeyininyüksekolması

(hipertrigliseridemi)ileilgili öyküsözkonusuise

Yüzünüzdeveyavücudunuzdakahverengilekelenmeler(kloazma)varsa(bkz.

" ELLEACNELLEvesolaryumlarilebronzlaşmacihazları")

8/17

GebeliksırasındaveyaöncedendoğumkontrolhapıyadaELLEACNELLE

kullanırkenkötüleşenbirhastalığınızvarsa(bkz.Bölüm“4.OlasıYanEtkiler

Nelerdir?”)

Bu durumlardan herhangibi rininsiziniçingeçerliisedoktorunuzasöyleyiniz.Ayrıca

ELLEACNELLEkullanmayıbırakmanızgerekebileceğinden,budurumlardanherhangibirini

builacıkullanırkenilkkezyaşadıysanızveyabudurumlarkötüleşmişyadatekrarlamışise

doktorunuzabelirtmenizgerekir.

ELLEACNELLEvesolaryumlarilebronzlaşma cihazları

Bazıkadınlaraknelerdenkurtulmakveyabronzlaşmakiçinsolaryumkullanır.Bu,akneiçin

pekfaydalıbirtedaviyöntemideğildir.ELLEACNELLEkullanırkensolaryumagirmeyin

veyabronzlaşmacihazıkullanmayınveuzunsüregüneşlenmektenkaçının.Bunların

kullanımıcilttelekelenmeşeklinderenkdeğişikliğinenedenolankloazmariskiniartırır

(normaldoğumkontrolhaplarıdabu riskiartırır).

Adetperiyotlarındadeğişiklikler

Adetkanamas ının azalması:Bu durumolağan dışıdeğildirvebazıkadınlardaolmasıbeklenir.

Adetkanmamasınınolmaması:Bazenadetkanamasıhiçolmaz.Drajelerdoğruolarak

alındıysahamilelikmuhtemeldeğildir.Çekilmekanamasındaaksamadrajeyearaverilen

dönemde gerçekleşirse,gebeolmaihtimalinizekarşın doktorunuzadanışınız.

Periyotlararasındakanama:Düzensizkanama(lekelenmeveyaarakanama)özellikle

kullanımınilkaylarındaortayaçıkabilir.Bunedenle,düzensizkanamalarınoluşumuancak

yaklaşıküçdöngüsürenadaptasyondönemindensonraönemkazanmaktadır.Önceden

düzenliolandöngülersonrasındakanamadüzensizlikleriortayaçıktığıveyavarolan

düzensizliklerdevamettiğitakdirdedoktorunuzadanışınız.

ELLEACNELLEkesildiktensonrabazıkadınlardaözellikleöncedenbutipsorunları

olanlardaamenore(adetgörememe)veyaoligomenore(adetgecikmesi)gelişebilir.

Buuyarılar,geçmiştekiherhangibirdönemdedahiolsasiziniçingeçerliyse,lütfen

doktorunuzadanışınız.

ELLEACNELLE’inyiyecekveiçecek ilekullanılması

ELLEACNELLE kullanımısırasındayiyecekveiçeceklerhakkındaherhangiözelbirtalimat

yoktur.

Hamilelik

İlacıkullanmadan öncedoktorunuza veyaeczacınıza danışınız.

ELLEACNELLEhamilelikte kullanılmamalıdır.ELLEACNELLEkullanımısırasında

hamilelikmeydanagelirsekullanımdurdurulmalıdır.Hamileolduğunuzdan

şüpheleniyorsanız,ELLEACNELLEkullanmayıbırakmadanöncehamileliktestiyaparak

durumdan emin olun.

Tedavinizsırasındahamileolduğunuzufarkedersenizhemendoktorunuzaveyaeczacınıza

danışınız.

9/17

Emzirme

ELLEACNELLEemzirirkenkullanılmamalıdır.

İlacıkullanmadan öncedoktorunuza veyaeczacınıza danışınız.

Araç ve makinekullanımı

ELLEACNELLE kullanımınınaraç ve makinekullanmabecerileriüzerindeherhangibir

etkisi yoktur.

ELLEACNELLE’iniçeriğindebulunanbazıyardımcımaddelerhakkındaönemli

bilgiler

ELLEACNELLE,laktozvesukroziçermektedir. Eğerdahaöncedendoktorunuztarafından

bazışekerlerekarşıtahammülsüzlüğünüz(intoleransınızın)olduğusöylenmişse,butıbbi

ürünüalmadan öncedoktorunuza danışınız.

Diğerilaçlarilebirliktekullanımı

ELLEACNELLEkullanırkenaynızamandabaşkabirilaçdahaalmanızgerektiğinde,

doktorunuza,eczacınızaveyadişhekiminizeELLEACNELLEkullandığınızımutlaka

söyleyiniz. Ayrıca,hormonaldoğumkontrolhaplarıylabirliktealınıpalınamadığınıöğrenmek

içinilaçlarınızlabirlikteverilenkullanmatalimatlarınıdakontroledin.

CiltleilgilibirtedaviiçinELLEACNELLEkullanıyorsanız,aynızamandadiğerbirhormonal

doğumkontrolhapıkullanmamalısınız.

BazıilaçlarkandakiELLEACNELLEdüzeyinietkileyebilirvenormaletkigöstermesini

engelleyebilir, örneğin:

Epilepsitedavisindekullanılan bazıilaçlar

HIVveHepatitCVirüsüenfeksiyonlarınıntedavisindekullanılanbazıilaçlar(proteaz

inhibitörlerivenon-nükleozid terstranskriptazinhibitörleri)

Griseofulvin(birmantarilacı)

Bazıantibiyotikler(oraltetrasiklinler,rifampisin)

Bazıyatıştırıcılar(barbitüratlar)

St.John’sWort(Sarıkantaron otu, bitkiselbirilaç).

BuilaçlardanherhangibirinikullanmanızgerekiyorsaELLEACNELLEsiziniçinuygun

olmayabiliryadabirsüreilavebirdoğumkontrolyöntemikullanmanızgerekebilir.Böylebir

durumgerektiğindevesüresininnekadarolacağıkonusundadoktorunuz,eczacınızveyadiş

hekiminizsizi bilgilendirecektir.

ELLEACNELLEdediğerilaçlarınetkisinideğiştirebilir.Doktorunuzundiğerilacındozunu

ayarlamasıgerekebilir.

AyrıcaELLEACNELLEbazıkantetkiklerininsonuçlarınıetkileyebilir;bunedenle,kan

tetk ikyaptırdığınızdaELLEACNELLEkullanmaktaolduğunuzudoktorunuzamutlaka

söylemelisiniz.

Eğerreçeteliyadareçetesizherhangibirilacışuandakullanıyorsanızveyasonzamanlarda

kullandınıziselütfen doktorunuza veyaeczacınıza bunlarhakkında bilgi veriniz.

10/17

3.ELLEACNELLEn asılkullanılır?

Uygunkullanımvedoz/uygulama sıklığıiçintalimatlar:

Doktorunuzyüzünüzdekiveyavücudunuzdakiakneyadaaşırıkıllanmaiçintedaviolarak

ELLEACNELLE'iseçmiştir.Bununlabirlikte,ELLEACNELLEdoğumkontroletkiside

gösterdiğinden,doğumkontroliçinELLEACNELLE'egüveniyorsanız,aşağıdakitavsiyeleri

dikkatealmanızönemlidir.

ELLEACNELLE'isadeceakneveaşırıkıllanmaiçinkullanıyorsanızdabutavsiyeye

uyabilirsiniz, ancak emin değilsenizdoktorunuzadanışınız.

21 gün boyuncahergünELLEACNELLEkullanın.

ELLEACNELLE,herbirindehaftanınbirgünüişaretlenmişolan21drajedenoluşanblister

halindesunulur.

Drajelerihergün aynısaattealın.

Haftanın doğrugünününişaretlendiğidrajeyialarak başlayın.

Blisterüzerindekiokyönünütakipedin.21hapıntamamıbitenekadarhergünbir

drajealın.

Herdrajeyi bütünolarakyutun; istersenizsuylabirlikteiçebilirsiniz.Drajeyi

çiğnemeyiniz.

Sonrayedigün drajeyearaverin.

Blisterdeki21drajenintamamınıaldıktansonra,drajealımınayedigünaraverin.Blisterdeki

sondrajeyialdıktanbirkaçgünsonra,adetkanamasınabenzerbirçekilmekanamasıolması

gerekir.Bu kanamabirsonrakipaketebaşlamanızgereken zamandakesilmemişolabilir.

Gebeliğiönlemekiçinbuilacagüveniyorsanız,ELLEACNELLE'iherzamanburada

belirtildiğişekildekullanın.Drajeleridoğruşekildealdığınızvesonrakipaketezamanında

başladığınızsürece,drajealımınaaraverdiğinizyedigünlükdönemdeilavedoğumkontrol

yöntemikullanmanızagerekyoktur.Eminolmadığınızbirdurumolduğundadoktorunuza

danışınız.

Sekizincigündeyenipaketebaşlayınız.Drajealmadığınızyedigünlüksüredensonrayeni

paketebaşlayın(sekizincigünde)-kanamanızdevamediyorolsadahiböyleyapmalısınız.

Yani,pakettekisondrajeyiCumagünüaldıysanızsonrakipaketinilkdrajesiniizleyen

haftanın Cumartesigünüalmanızgerekir. Sonrakipaketemutlakazamanındabaşlayın.

ELLEACNELLE'idoğrukullandığınızsürece,heryenipaketehaftanınaynıgününde

başlamanızgerekir.

ELLEACNELLE'eyenibaşlayanlarveya ara verdiktensonra yenidenbaşlayanlar

İlkELLEACNELLEdrajesibirsonrakiadetdöneminizinilkgünündealınmalıdır.Buşekilde

başladığınızda, ilk drajenin alınmasıylabirliktedoğumkontrolü başlamışolacaktır.

11/17

Başka birdoğumkontrolhapındanELLEACNELLE'egeçişyapılması

21günlükbirdoğumkontrolhapıkullanıyorsanız:Öncekipaketbittikten sonraki

gün ELLEACNELLE'ebaşlayın.İlkdrajeninalınmasıylabirliktedoğumkontrolü

başlamışolacaktır.İlkELLEACNELLEpaketinikullanırkenkanamanızolmayacaktır.

İlk paketinbitiminden sonrakanamabaşlayacaktır.

28günlükbirdoğumkontrolhapıkullanıyorsanız:Sonaktifhapıaldıktansonraki

günELLEACNELLEku llanmayabaşlayın.İlkdrajeninalınmasıylabirliktedoğum

kontrolü başlamışolacaktır.İlkELLEACNELLEpaketininsonunakadarkanama

olmamasıgerekir.

Sadeceprogestojeniçerenbiryöntemdengeçiş:Kanamanınbaşladığıgün,ogün

yalnızcaprogesteroniçerendoğumkontrolhapınıalmışolsanızdahi,

ELLEACNELLE' ebaşlayın.Doğumkontrolü hemen başlamışolacaktır.

Düşükveya kürtajsonrasıELLEACNELLE'ebaşlama

Gebeliğinilküçayındadüşükyaptıysanızveyakürtajolduysanız,doktorunuz

ELLEACNELLE kullanımınahemenbaşlamanızgerektiğinisöyleyebilir.Bununanlamıilk

drajenin alınmasıylabirliktedoğumkontrolü başlamışolacağıdır.

Gebeliğinizinilküçayındansonradüşükyaptıysanızveyakürtajolduysanız,doktorunuza

danışınız.Kısabirsüreiçinilavebirdoğumkontrolyöntemi(meselakondom)kullanmanız

gerekebilir.

Doğumdansonra doğumkontrolü

Yenidoğumyaptıysanız,tamamenayağakalkmışolmanızkaydıyla,doktorunuzdoğumdan

21günsonraELLEACNELLEkullanmayabaşlamanızıönerebilir.Adetdönemini

beklemenizegerekyoktur. ELLEACNELLE' ebaşlayanakadarvedrajealdığınızilk7gün

boyuncakondomgibi ilavebirdoğumkontrolyöntemikullanmanızgerekecektir.

ELLEACNELLE,emzirirkenkullanılmamalıdır.

Uygulama yoluvemetodu:

ELLEACNELLE,birmiktar suilealınmalıdır.

DoktorunuzELLEACNELLEiletedavinizin nekadarsüreceğinisizebildirecektir.

Değişikyaşgrupları:

Çocuklarda kullanımı:İlk adetgörmeden sonraendikedir.

Yaşlılarda kullanımı:Yaşlılardakullanımıyoktur. Menopozdan sonraendikedeğildir.

Özelkullanımdurumları:

Karaciğeryetmezliği:ELLEACNELLEşiddetlikaraciğerhastalıklarıolankadınlarda

kullanılmamalıdır.

Böbrekyetmezliği:ELLEACNELLEböbrekyetmezliğiolanhastalardaözelolarak

araştırılmamıştır.Mevcutverilerbuhastalarıntedavisindebirdeğişiklikyapılmasınıileri

sürmemektedir.

12/17

EğerELLEACNELLE’inetkisininçokgüçlüveyazayıfolduğunadairbirizleniminizvarise

doktorunuzveyaeczacınızilekonuşunuz.

Kullanmanızgerekendendahafazla ELLEACNELLEkullandıysanız:

Aşırıdozdakullanımındabulantı,kusmaveyahafifvajinalkanamagörülebilir.Eğersizdebu

belirtilervarsadoktorunuzabaşvurunuz.

ELLEACNELLE’denkullanmanızgerekendenfazlasınıkullanmışsanızbirdoktorveyaeczacı

ilekonuşunuz.

ELLEACNELLE’i kullanmayıunutursanız:

Birdrajeninunutulması

Drajeyialmayıunutmanızınüzerinden12saattendahaazzamangeçtiysedrajeyihemenalın.

Sonrakidrajelerideherzamankigibialmayadevamedin.Bu, birgündeikidrajealmak

anlamınagelebilir.Endişelenmeyiniz, korunmanızdaazalmaolmaz.

Drajeyialmayıunutmanızınüzerinden12saattenfazlazamangeçtiyseveyabirdenfazla

drajeyialmayıunuttuysanızgebeliğekarşıkorunmanızdaazalmaolabilir.

Aynıandaikidrajealmanızanlamınagelsebile,son unuttuğunuzdrajeyihatırlar

hatırlamazalın. Unutmuşolduğunuzdahaöncekidrajeleripakettebırakın.

Sonrakiyedigün boyuncaherzamankigibihergün birdrajealmayadevamedin.

Buyedigünlük süreiçindepaketin sonunagelirseniz,yedigünlük aravermedenbir

sonrakipaketedevamedin.İkincipakettekidrajelerbitenekadarbüyükihtimalle

kanama meydanagelmeyecektiramaendişelenmeyin.İkincipaketteki drajeleri

bitirdiysenizve kanamayoksabaşkabirpaketebaşlamadanöncebirgebeliktesti

yapın.

Birdr ajeyialmayıunuttuktansonrayedigünboyuncakondomgibiilavebirdoğum

kontrolyöntemikullanın.

İlkhaftaiçindepakettenbirveyadahafazladrajekullanmayıunutursanız(1-7 gün

içinde)veohaftacinselilişkiyegirdiyseniz,gebeolmaihtimalinizsözkonusu olur.

En kısasürededoktorunuzaveyaeczacınızadanışın.

Birpakettekidrajelerdenherhangibirinialmayıunutursanızveilkdrajesizdönemde

kanamaolmazsa,gebelik ihtimalinidikkatealmalısınız.Doktorunuzlailetişimegeçin

yada birgebelik testiyapın.

Yenipaketdrajelerebaşlamadagecikirsenizveyayedigündenfazlaaraverirseniz,gebeliğe

karşıkorumanızolmayabilir.Sonyedigüniçerisindecinselbirleşmeyaşadıysanız,

doktorunuzaveyaeczacınızadanışınız.Ayrıcayedigünsüreyle,kondomgibiekstrabir

doğumkontrolyöntemikullanmanızgerekebilir.

Kayıpdraje

Birdrajeyikaybederseniz,

I. alternatif kaybettiğinizdrajeyerinepaketüzerindekisonhapıalın.Sonradiğertüm

drajelerigerekengünlerindealın.Döngünüznormaldenbirgünkısaolacak,ancakgebeliğe

karşıkorunmanızetkilenmeyecektir.Yedigünlükdrajesizdöneminardından,yenibir

başlangıçgününüzolacaktır(eskisinden birgün önce).

II. alternatif Döngünüzünbaşlangıçgününüdeğiştirmekistemiyorsanız,fazladanbir

ketinizvarsaopakettenbirhapalabilirsiniz.Sonrageçerlipaketinizdekidiğertümdrajeleri

13/17

herzamankigibialın.Başkadrajeleridekaybedebilmeihtimalinizekarşıaçmışolduğunuz

yedekpaketi saklayabilirsiniz.

Hasta veya ishalolduğunuzda

Hastaysa nız(kusmanızvarsa)veyaağırishalinizvarsa,vücudunuziçtiğinizdrajedenher

zamankidozu alamayabilir.ELLEACNELLE aldıktan12saatsonradahaiyihissediyorsanız,

Kayıpdraje”bölümündekitalimatlarıizleyin vebirbaşkadrajealın.

ELLEACNELLEald ıktan12saattenuzunbirsüresonrahalenhastaysanızveyaishaliniz

devamediyorsa, “ Birdrajeninunutulması”bölümünebakınız.

Midebozukluğunuzdevamederseveyakötüleşirsedoktorunuzasöyleyin.Doktorunuzfarklı

birdoğumkontrolyöntemikullanmanızıönerebilir.

Biradetkanamasınınatlanması–gebeolabilirmisiniz?

Bazençekilmekanamasımeydanagelmeyebilir.Budurum,gebeolabileceğinizanlamına

gelebilsede,drajeleridoğruşekildekullandıysanızgenelliklepekolasıdeğildir.Birsonraki

paket inizenormalzamanındabaşlayın.Gebekalmariskinizolduğunudüşünüyorsanız

(örneğin,drajealmayıunuttuysanızveyabaşkailaçlarkullandıysanız)yadaikincikanamada

olmamışsa,gebeliktestiyapmanızgerekir.Butestlerieczanedensatınalabilirveya

doktorunuzabaşvurabilirsiniz.GebeysenizELLEACNELLEalmayıbırakınızvedoktorunuza

başvurunuz.

ELLEACNELLEiletedavisonlandırıldığındaoluşabileceketkiler:

ELLEACNELLE’idilediğinizherzaman bırakabilirsiniz.

4. Olasıyanetkilernelerdir?

Tüm il açlargibiELLEACNELLE’iniçeriğindebulunanmaddelereduyarlıolankişilerdeyan

etkilerolabilir.

İlaçkullanımıylailişkiliciddireaksiyonlardahilyanetkileriçinayrıca‘ELLEACNELLE’i

aşağıdakidurumlardaKULLANMAYINIZveELLEACNELLE’iaşağıdakidurumlarda

DİKKATLİKULLANINIZ’bölümlerinebakınız.Bubölümleridikkatleokuyunuzve

gerekirsederhaldoktorunuzabaşvurunuz.

ELLEACNELLEkullanan tümkadınlardatromboembolizmriskiartmaktadır.

Aşağıdakilerdenherhangibirinifarkederseniz,hemendoktorunuzabildiriniz veyasize

enyakınhastaneninacilbölümünebaşvurunuz:

Şiddetlidepresyon:

ELLEACNELLE'indoğrudanbiryanetkisiolarakkabuledilmemeklebirlikte,bazı

kadınlardaELLEACNELLEkullanımısırasındadepresyonbildirilmiştir. Çoknadirolarak, bu

durumkişininyaşamınasonvermedüşüncesiyleilişkilendirilmiştir.Şiddetlidepresyon

gelişmesihalinde,önlemolarakELLEACNELLEkullanmayıbırakmalıvederhal

doktorunuzlagörüşmelisiniz.

Kanpıhtısıbulguları:

Alışılmadık aniöksürük,

14/17

Solko layayılanyadayayılmayanşiddetligöğüsağrısı,

Soluksuzluk,

Şiddetlenen migrenyadaalışılmadık, uzun süren,şiddetlibaşağrısı,

Kısmiveyatamkörlükyadaçiftgörme,

Peltek konuşmaveyakonuşmabozukluğu,

Duyma, kokualma, tatalmaduyularındaanideğişiklikler,

Başdönmesiveyabayılma,

Vücudun herhangibirbölgesindegüçsüzlük veyauyuşma,

Karın bölgesindeşiddetliağrı,

Bacaklardan birindeşiddetliağrıveyaşişme.

Şiddetlialerjikreaksiyonveya kalıtsalanjiyoödemdekötüleşmeyleilgilibelirtiler:

Ellerde,yüzde,dudaklarda,ağızda,dildeveyaboğazdaşişme.Dilde/boğazdaşişme

olmasıyutmavesoluk almadazorluğaneden olabilir.

Kırmızıkabarık döküntü (kurdeşen)vekaşıntı.

Meme kanseribelirtileri:

Ciltteçukurlaşma

Memeucundadeğişiklik

Görebildiğinizveyahissedebildiğinizhertürlüyumru

Rahimağzıkanserininbelirtileri:

Kötü kokulu ve/veyakaniçeren vajinalakıntı

Anormalvajinalkanama

Pelvik ağrı

Ağrılıcinselbirleşme.

Ciddikaraciğerbozukluklarınınbelirtileri:

Karındaşiddetli ağrı

Ciltteveyagözlerdesararma(sarılık)

Karaciğeriltihabı(hepatit)

Tümvücuttakaşıntıbaşlaması.

Bunların hepsiciddiyanetkilerdir. Aciltıbbimüdahalegerekebilir.

Yanetkileraşağıdakikategorilerdegösterildiğişekildesıralanmıştır:

Çok y aygın:10 hastanınen az1 indegörülebilir.

Yaygın:10 hastanın birinden az, fakat100 hastanın birinden fazlagörülebilir.

Yaygın olmayan:100 hastanın birinden az, fakat1.000 hastanın birinden fazlagörülebilir.

Seyrek:l.000 hastanın birinden az, fakat10.000 hastanın birinden fazlagörülebilir.

Çok seyrek:10.000 hastanın birinden azgörülebilir.

Bilinmiyor: Eldeki verilerdentahminedilemiyor.

Yaygın:

Depresifduygu durumu, duygu durumdeğişiklikleri

Başağrısı

Bulantı, karın ağrısı

Kilodaartış

15/17

Mem eağrısı,memehassasiyeti

Yaygınolmayan:

Sıvıtutulumu

Cinselistekazalması

Migren

Kusma, ishal

Döküntü, kurdeşen

Memede büyüme

Seyrek:

Aşırıduyarlılık

Cinselistekartışı

Toplardamardakan pıhtısı(Tromboembolizm)

Kontaktlensetahammülsüzlük

Bacak vekollardaoluşanağrılışişliklerleseyredendöküntülühastalık(eritema

nodozum),

Ağızdavetümvücuttaderininsutoplamasıilekendinigösterenbirhastalık(eritema

multiforme)

Kilodaazalma

Vajinalakıntı

Memedeakıntı

ELLEACNELLE gibiilaçlarıkullanankadınlarda,bölüm‘ELLEACNELLE’iaşağıdaki

durumlarda DİKKATLİKULLANINIZ’başlıklıkısımdatartışılanaşağıdakiciddiyan

etkiler bildirilmiştir:

Venöztromboembolikbozukluklar(toplardamarlardakanpıhtısıoluşumusonucu

tıkanma)

Arteryel tromboem bolikbozukluklar(atardamarlardakanpıhtısıoluşumusonucu

tıkanma)

İnmeler(örn.,geçiciiskemik atak, iskemik inme, hemorajik inme)

Yüksek tansiyon(hipertansiyon)

Karaciğertümörleri(iyiveyakötü huylu)

Bildirilendiğeryanetkiler

Adetdönemlerini zarasındakanamavelekelenmebazenilkaylardameydanagelebilir

ancak bu durumgenelliklevücudunuzELLEACNELLE' ealıştıktansonrasonaerer.

Bu durum devamederse,yoğunlaşırsaveyayeniden başlarsa, doktorunuzlagörüşün.

Kloazma(cilttesarı-kahverengilekelenmeler).Bu durumELLEACNELLE aylarca

kullanıldığıtakdirdeortayaçıkabilir.Kloazma,güneşışığınave/veyaUVlambalara

çokfazla maruz kalmanınönlenmesiyleazaltılabilir.

Hareketbozukluğugelişmesiveyakötüleşmesi

Crohnhastalığı(kronikiltihabibağırsakhastalığı)veyaülseratifkolit(kalınbarsağın

iltihaplıbirhastalığı).

Hipertrigliseridemi(belirlikanyağlarında(trigliseritler)artış)Gebeliksırasındaveya

öncekidoğumkontrolhapıkullanımıylakötüleşebilen durumlar:

-deride sararma (sarılık)

- kalıcıkaşıntı(pruritus)

- böbrek veyakaraciğersorunları

16/17

- safrakesesitaşı

- sistemiklupuseritematozus(eklemağrılarıvederidöküntülerinesebepolanbir

hastalık)gebelik sırasındasu toplamayabenzerdöküntü (herpesgestastionis)

- kalıtsalbirsağırlık formu (otoskleroz)

- orakhücrelianemi(kalıtsalkanhastalığı)yadabirformuileilgiliöyküveyaaile

öyküsü

- vücutbölgelerindeşişme(kalıtsalanjiyoödem)

- porfiriadıverilenkalıtsalbirhastalık

- rahimağzıkanseri

KOK veyaELLEACNELLEku llanankadınlardaglukoztoleransında(şekerinetkisine

dayanıklılık)değişimlerveyaperiferikinsülindirenci(vücuttadolaşaninsülinhormonuna

karşıgösterilendirenç)üzerineetkibildirilmiştir(bkz.bölüm“ELLEACNELLE’iaşağıdaki

durumlarda DİKKATLİKULLANINIZ”).

ELLEACNELLE 'denkaynaklandığınıdüşündüğünüzherhangibiryanetkihakkında

endişelerinizvarsadoktorunuzveyaeczacınızilegörüşün.AyrıcaELLEACNELLE

kullanırken mevcutherhangibirrahatsızlığınızdakötüleşmeolursadadoktorunuzasöyleyin.

Adetdönemleriarasındakikanamalarınuzunsürmesibeklenmez.

AzsayıdakadındaELLEACNELLEkullandıklarısırada,özellikleilkbirkaçayiçerisinde

olmaküzere,beklenmedikhafifkanamalarveyalekelenmelermeydanagelmiştir.Genellikle,

bu tip ka namaiçinendişelenilmesigerekmezvebirveyaikigüniçerisindesonaerer.

ELLEACNELLE'iherzamankigibikullanmayadevamedin. Sorunun ilk birkaçpaketten

sonradüzelmesibeklenir.

Ayrıca,drajeleridüzenliolarakalmadığınızdabeklenmedikkanamalarmeydanagelebilir. Bu

nedenledrajelerihergünaynısaattealmayaözengösterin.Ayrıca,beklenmedikkanama

bazen diğerilaçlardan dakaynaklanabilir.

Aşağıdakiözellikleresahip anikanamaveyalekelenmeolduğundadoktorunuzabaşvurunuz:

İlk birkaçaydanuzun süren,

ELLEACNELLE'ibirsürekullandıktan sonrabaşlayan,

ELLEACNELLEkullanmayıbıraktıktan sonradevameden.

Eğerbukullanmatalimatındabahsigeçmeyenherhangibiryanetkiilekarşılaşırsanız

doktorunuzu veyaeczacınızıbilgilendiriniz.

Yane tkilerin raporlanması

Kullanmatalimatındayeralanveyaalmayanherhangibiryanetkimeydanagelmesi

durumundahekiminiz,eczacınızveyahemşirenizilekonuşunuz.Ayrıcakarşılaştığınızyan

etkileriwww.titck.gov.trsitesindeyeralan“İlaçYanEtkiBildirimi”ikonunatıklayarakya

da,08003140008numaralıyanetkibildirimhattınıarayarakTürkiyeFarmakovijilans

Merkezi (TÜFAM)’nebildiriniz.Meydanagelenyanetkileri bildirerekkullanmakta

olduğunuzilacıngüvenliliğihakkındadahafazlabilgiedinilmesinekatkısağlamış

olacaksınız.

17/17

5.ELLEACNELLE’ins aklanması

ELLEACNELLE’içocuklarıngöremeyeceği,erişemeyeceğiyerlerdeveorijinalambalajında

saklayınız.

Herhangibirözelsaklamatalimatıyoktur.

Sonkullanma tar ihiyleuyumluolarakkullanınız.

AmbalajındakisonkullanmatarihindensonraELLEACNELLE’ikullanmayınız.Sonkullanma

tarihinin ilkikirakamıayı, son dörtrakamıyılıgösterir.

Eğerüründeve/veyaambalajındabozukluk fark edersenizELLEACNELLE’ikullanmayınız.

Bu tıbbiürün hakkındaherhangibirbilgiiçin lütfen RuhsatSahibiiletemasageçiniz.

Ruhsat sahibi: DemİlaçSanayiveTicaretA.Ş.

Dem Plazaİnönü Mah.KayışdağıCad.

No:172 34755 Ataşehir-İSTANBUL

Telefon:02164284029

Faks:02164284086

Üretimyeri:HauptPharmaMünsterGmbH,

Schleebrüggenkamp 15, 48159 Münster, Almanya

Bukullanma talimatı../../….tarihindeonaylanmıştır.

Document Outline

30-10-2018

FDA takes action to stop the use of lead acetate in hair dyes

FDA takes action to stop the use of lead acetate in hair dyes

FDA takes action to stop the use of lead acetate in hair dyes. FDA will no longer allow lead acetate to be used in certain hair coloring products based on data that demonstrate that there is no longer a reasonable certainty of no harm from the use of this color additive.

FDA - U.S. Food and Drug Administration

10-8-2018

FDA approves new vaginal ring for one year of birth control

FDA approves new vaginal ring for one year of birth control

FDA approved Annovera (segesterone acetate and ethinyl estradiol vaginal system), a combined hormonal contraceptive for women of reproductive age used to prevent pregnancy and is the first vaginal ring contraceptive that can be used for an entire year.

FDA - U.S. Food and Drug Administration

29-5-2018

TAYTULLA (norethindrone acetate and ethinyl estradiol capsules and ferrous fumarate capsules) by Allergan: Recall - Due to Out of Sequence Capsules

TAYTULLA (norethindrone acetate and ethinyl estradiol capsules and ferrous fumarate capsules) by Allergan: Recall - Due to Out of Sequence Capsules

Allergan recently identified, through a physician report, that four placebo capsules were placed out of order in a sample pack of TAYTULLA. Specifically, the first four days of therapy had four non-hormonal placebo capsules instead of active capsules. As a result of this packaging error, oral contraceptive capsules, that are taken out of sequence, may place the user at risk for contraceptive failure and unintended pregnancy. The reversing of the order may not be apparent to either new users or previous ...

FDA - U.S. Food and Drug Administration

29-5-2018

Allergan Issues Nationwide Voluntary Recall of TAYTULLA® Softgel Capsules 1mg/20mcg Sample Packs Due to Out of Sequence Capsules

Allergan Issues Nationwide Voluntary Recall of TAYTULLA® Softgel Capsules 1mg/20mcg Sample Packs Due to Out of Sequence Capsules

Allergan plc (NYSE:AGN) today issued a voluntary recall in the US market of one lot (Lot# 5620706, Expiry May-2019) of TAYTULLA® (norethindrone acetate and ethinyl estradiol capsules and ferrous fumarate capsules) 1mg/20mcg, 6x28 physicians sample pack, indicated for use by women to prevent pregnancy. Allergan recently identified, through a physician report, that four placebo capsules were placed out of order in a sample pack of TAYTULLA. Specifically, the first four days of therapy had four non-hormonal...

FDA - U.S. Food and Drug Administration

15-3-2018

Health Canada to conduct review of a new potential safety risk of Fibristal (ulipristal acetate), a medication used to treat fibroids

Health Canada to conduct review of a new potential safety risk of Fibristal (ulipristal acetate), a medication used to treat fibroids

OTTAWA - Health Canada is advising Canadians that it will be conducting a safety review of Fibristal (ulipristal acetate), a medication used to treat uterine fibroids in women. Health Canada's review is a result of Canadian and European reports of serious adverse events affecting the liver.

Health Canada

21-11-2018

Osurnia (Elanco GmbH)

Osurnia (Elanco GmbH)

Osurnia (Active substance: terbinafine / florfenicol / betamethasone acetate) - Centralised - Transfer Marketing Authorisation Holder - Commission Decision (2018)7842 of Wed, 21 Nov 2018 European Medicines Agency (EMA) procedure number: EMEA/V/C/003753/T/0010

Europe -DG Health and Food Safety

21-11-2018

EU/3/18/2086 (Santhera Pharmaceuticals (Deutschland) GmbH)

EU/3/18/2086 (Santhera Pharmaceuticals (Deutschland) GmbH)

EU/3/18/2086 (Active substance: Cyclo[L-alanyl-L-seryl-L-isoleucyl-L-prolyl-L-prolyl-L-glutaminyl-L-lysyl-L-tyrosyl-D-prolyl-L-prolyl-(2S)-2-aminodecanoyl-L-alpha-glutamyl-L-threonyl]acetate) - Orphan designation - Commission Decision (2018)7795 of Wed, 21 Nov 2018 European Medicines Agency (EMA) procedure number: EMA/OD/106/18

Europe -DG Health and Food Safety

1-10-2018

EU/3/03/133 (Shire Orphan Therapies GmbH)

EU/3/03/133 (Shire Orphan Therapies GmbH)

EU/3/03/133 (Active substance: Icatibant acetate) - Transfer of orphan designation - Commission Decision (2018)6432 of Mon, 01 Oct 2018 European Medicines Agency (EMA) procedure number: EMA/OD/054/02/T/01

Europe -DG Health and Food Safety

29-8-2018

Ulipristal Acetate Gedeon Richter (Gedeon Richter Plc.)

Ulipristal Acetate Gedeon Richter (Gedeon Richter Plc.)

Ulipristal Acetate Gedeon Richter (Active substance: Ulipristal Acetate) - Centralised - Authorisation - Commission Decision (2018)5779 of Wed, 29 Aug 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/5017

Europe -DG Health and Food Safety

28-8-2018

EU/3/18/2058 (IQVIA RDS Ireland Limited)

EU/3/18/2058 (IQVIA RDS Ireland Limited)

EU/3/18/2058 (Active substance: 1-(3-methylbutanoyl)-L-aspartyl-L-threonyl-L-histidyl-L-phenylalanyl-L-prolyl-(L-cystinyl-L-isoleucyl-[(N6-(S)-4-carboxy-4-palmitamidobutanoyl)-L-lysinyl]-L-phenylalanyl-L-glutamyl-L-prolyl-L-arginyl-L-serinyl-L-lysinyl-L-glycinyl-L-cystinyl)-L-lysinamide, disulfide, acetate) - Orphan designation - Commission Decision (2018)5730 of Tue, 28 Aug 2018 European Medicines Agency (EMA) procedure number: EMA/OD/099/18

Europe -DG Health and Food Safety

6-8-2018

Cetrotide (Merck Europe B.V.)

Cetrotide (Merck Europe B.V.)

Cetrotide (Active substance: Cetrorelix (as acetate)) - Centralised - Transfer Marketing Authorisation Holder - Commission Decision (2018)5373 of Mon, 06 Aug 2018 European Medicines Agency (EMA) procedure number: EMEA/H/C/233/T/67

Europe -DG Health and Food Safety

12-6-2018

EU/3/17/1834 (Santhera Pharmaceuticals (Deutschland) GmbH)

EU/3/17/1834 (Santhera Pharmaceuticals (Deutschland) GmbH)

EU/3/17/1834 (Active substance: Cyclo[L-alanyl-L-seryl-L-isoleucyl-L-prolyl-L-prolyl-L-glutaminyl-L-lysyl-L-tyrosyl-D-prolyl-L-prolyl-(2S)-2-aminodecanoyl-L-alpha-glutamyl-L-threonyl]acetate salt) - Transfer of orphan designation - Commission Decision (2018)3797 of Tue, 12 Jun 2018 European Medicines Agency (EMA) procedure number: EMA/OD/244/16/T/01

Europe -DG Health and Food Safety

12-6-2018

EU/3/13/1114 (Santhera Pharmaceuticals (Deutschland) GmbH)

EU/3/13/1114 (Santhera Pharmaceuticals (Deutschland) GmbH)

EU/3/13/1114 (Active substance: Cyclo[L-alanyl-L-seryl-L-isoleucyl-L-prolyl-L-prolyl-L-glutaminyl-L-lysyl-L-tyrosyl-D-prolyl-L-prolyl-(2S)-2-aminodecanoyl-L-alpha-glutamyl-L-threonyl] acetate salt) - Transfer of orphan designation - Commission Decision (2018)3798 of Tue, 12 Jun 2018 European Medicines Agency (EMA) procedure number: EMA/OD/166/12/T/01

Europe -DG Health and Food Safety

29-5-2018

Osurnia (Elanco Europe Ltd)

Osurnia (Elanco Europe Ltd)

Osurnia (Active substance: terbinafine / florfenicol / betamethasone acetate) - Centralised - Yearly update - Commission Decision (2018)3406 of Tue, 29 May 2018

Europe -DG Health and Food Safety