DIANE-35

Genel Bilgiler

  • Ticaret Unvanı:
  • DIANE-35 21 DRAJE
  • Reçete türü:
  • Normal
  • İçin kullanmak:
  • İnsanlar
  • İlaç türü:
  • allopatik ilaç

Belgeler

Yerelleştirme

  • Bulunduğu ülkeler::
  • DIANE-35 21 DRAJE
    Türkiye
  • Dil:
  • Türkçe

Terapötik bilgiler

  • Terapötik alanı:
  • siproteron ve östrojen

Diğer bilgiler

Durum

  • Kaynak:
  • TİTCK - TÜRKİYE İLAÇ VE TIBBİ CİHAZ KURUMU - Türkiye
  • Yetkilendirme durumu:
  • Aktif
  • Yetkilendirme numarası:
  • 8699546120031
  • Yetkilendirme tarihi:
  • 18-10-2016
  • Son Güncelleme:
  • 24-05-2018

Hasta Bilgi broşürü: Ürün Özellikleri Özeti - kompozisyon, endikasyonlar, yan etkiler, dozaj, etkileşimleri, advers reaksiyonlar, gebelik, laktasyon

KULLANMATALİMATI

DIANE ® 35draje

Ağızyoluylaalınır.

Etkinmadde:Herdraje,2mgsiproteronasetatve0,035mgetinilestradioliçerir.

Yardımcımaddeler:laktozmonohidrat,mısırnişastası,povidon25,magnezyum

stearat,sukroz,povidon700000,makrogol6000,kalsiyumkarbonat,talk,gliserol%

85,titanyumdioksit,sarıdemiroksitpigmenti,kırmızıdemiroksitpigmenti,

montanglikolvaks

Builaçekizlemeyetabidir.Buüçgenyenigüvenlilikbilgisininhızlıolarakbelirlenmesini

sağlayacaktır.Meydanagelenherhangibiryanetkiyiraporlayarakyardımcıolabilirsiniz.Yan

etkilerinnasılraporlanacağınıöğrenmekiçin4.Bölümünsonunabakabilirsiniz.

BuilacıkullanmayabaşlamadanöncebuKULLANMATALİMATINIdikkatlice

okuyunuz,çünküsiziniçinönemlibilgileriçermektedir.

Bukullanmatalimatınısaklayınız.Dahasonratekrarokumayaihtiyaçduyabilirsiniz.

Eğerilavesorularınızolursa,lütfendoktorunuzaveyaeczacınızadanışınız.

Builaçkişiselolaraksizereçeteedilmiştir,başkalarınavermeyiniz.

Builacınkullanımısırasında,doktoraveyahastaneyegittiğinizdebuilacı

kullandığınızıdoktorunuzasöyleyiniz.

Butalimattayazılanlaraaynenuyunuz.İlaçhakkındasizeönerilendozundışında

yüksekveyadüşükdozkullanmayınız.

BuKullanmaTalimatında:

1.DIANE35nedirveneiçinkullanılır?

2.DIANE35kullanmadanöncedikkatedilmesigerekenler

3.DIANE35nasılkullanılır?

4.Olasıyanetkilernelerdir?

5.DIANE35’insaklanması

Başlıklarıyeralmaktadır.

1.DIANE35nedirveneiçinkullanılır?

DIANE35,21drajeliktakvimliblisterambalajlardabulunurvedrajelerbej

rengindedir.Herdrajeetkinmaddeolarak2mgsiproteronasetatve0,035mg

etinilestradioliçerir.

DIANE35östrojen(kadıncinsiyethormonlarındanbiri)veantiandrojenik(erkek

cinsiyethormonlarınınbazıdoğaletkilerinigideren)aktiviteyesahipprogesteron

(kadıncinsiyethormonlarındanbiri)hormonuiçerir.

DIANE35doğurganlıkçağındakikadınlardaaşırıyağlanmailebirlikteveyatek

başınaortadereceliilaşiddetliaknetedavisive/veyaaşırıkıllanmagibicilt

rahatsızlıklarınıntedavisindekullanılır.Doğumkontrolözelliklerinedeniyle,yalnızca

doktorunuzhormonalkontraseptif(doğumkontrolilacı)tedavisininuygunolduğunu

düşündüğütakdirdereçeteedilebilir.DIANE35,aknetedavisindeyalnızcacilde

uygulananveyatümvücuduetkileyenantibiyotiktedavisininbaşarısızolduğu

durumlardakullanılmalıdır.CiltleilgilibirtedaviiçinDIANE35kullanıyorsanız,

aynızamandafarklıbirhormonalkontraseptifkullanmamalısınız.

CiltsorununuzdüzeldiğindeveDIANE35kullanmayıbıraktığınızdadahaöncetercih

ettiğiniz/asılkontrasepsiyon(doğumkontrol)yönteminizegeridönmelisiniz.

Doğumkontrolhapıgibietkigösterdiğindendiğerhormonaldoğumkontrolhaplarla

birliktekullanılmamalıdır.

Ciltsorunlarınıntedavisi

Androjenlerderidekılgelişiminiveyağbezleriniuyaranhormonlardır.Çokfazlaandrojen

üretimiolduğundaveyaandrojenetkisineduyarlıysanız,yağbezleriçokfazlasebum

üretebilir.Budurumyağbezleriniblokeedebilirveböyleceenfeksiyongelişebilir,iltihaplı

aknenoktalarıoluşabilir.DIANE35androjenlerincildinizietkilemesinidurdururveüretilen

androjenmiktarınıazaltır.

Doğumkontrolü

DIANE3521günlükbirdoğumkontrolhapıdır;21günboyuncahergünbirdrajealınırve

sonraki7günboyuncahiçdrajealınmaz.

DIANE35Klamidya(cinselyollabulaşanbakteri)veyaHIVenfeksiyonu(AIDS)vediğer

cinselyollageçenhastalıklarakarşıkorumasağlamaz.Butiphastalıklarınbulaşmasıancak

kondomlarileönlenebilir.

DIANE35'ningebeliğiönlemesiiçinbelirtildiğişekildealınmasıgerekir.

2.DIANE35kullanmadanöncedikkatedilmesigerekenler

DIANE35’iaşağıdakidurumlardaKULLANMAYINIZ:

Herhangibirtıbbisorununuzveyahastalığınızvarsadoktorunuzasöyleyiniz.

AşağıdakidurumlardanherhangibirisiziniçingeçerliyseDIANE35kullanmayabaşlamadan

öncebunudoktorunuzabildiriniz.Budurumdadoktorunuzfarklıbirtedavialmanızıtavsiye

edebilir:

Eğer;

Eşzamanlıolarakbaşkabirhormonaldoğumkontrolyöntemikullanıyorsanız,

Gebeisenizveyagebeolduğunuzdanşüpheleniyorsanız,

Emziriyorsanız,

Memekanseriisenizveyaöncedenmemekanserinizvarsa,

Bacağınızda(tromboz),akciğerlerinizde(pulmonerembolizm)veyavücudunuzundiğer

birbölgesindekanpıhtısıvarsa(veyaöncedenolduysa),

Gelecektekalpkrizigöstergesiolabilecekbirhastalığınız(örn.göğüsteşiddetliağrıya

nedenolananjinapektoris)yadamini-inme(geçiciiskemikatak)varsa(veyaönceden

olduysa),

Serebravaskülerkazabulgusuveyaöyküsüvarsa(Kalpkriziveyainmevarsaveyadaha

öncedengeçirdiyseniz),

Atardamarlardakanpıhtısıoluşmariskiniartırabilecekbirhastalığınızvarsa.Budurum,

aşağıdakihastalıklariçingeçerlidir:

Kandamarlarınızıetkileyendiyabet(şekerhastalığı)

Çokyüksektansiyon

Kanınızdakiyağdüzeyininçokyüksekolması(kolesterolveyatrigliserid))

Toplardamarveyaatardamarlarınızdakanpıhtılaşmasıileilgilikalıtsalveyaedinilmiş

yatkınlığınızvarsa(örn.AktifleşmişproteinC(APC)direnci,antitrombin-IIIeksikliği,

proteinCeksikliği,proteinSeksikliği,Hiperhomosisteinemiveantifosfolipidantikorları

(antikardiyolipinantikorları,lupusantikoagülanı))

Görmebozukluklarıilebirliktemigreninizvarsa(veyaöncedenolduysa)

Herhangibirzamandaşiddetlikaraciğerhastalığınızolduysavedoktorunuzkaraciğer

testlerinizinhenüznormaledönmediğinisöylediyse

Karaciğertümörüvarlığıyadahikayenizvarsa,

lacıniçerdiğimaddelerdenbirinekarşıalerjinizvarsa.

Bukoşullardanherhangibiriilacıilkkullandığınızdabaşınızagelirsederhalkullanmayı

bırakınvedoktorunuzadanışınız.

DIANE35erkeklerdekullanılmaz.

DIANE35’iaşağıdakidurumlardaDİKKATLİKULLANINIZ:

Kullanımsüresi

Belirtilerinhafiflemesinekadargeçensüreenazüçaydır.Tedaviyisürdürmeihtiyacı,tedavi

edendoktortarafındandüzenliolarakdeğerlendirilmelidir.

KullanmayabaşlamadanönceveyakullanmadevametmekararıverirkenDIANE35

kullanımınınfaydalarınıverisklerinianlamanızönemlidir.DIANE35çoğusağlıklıkadıniçin

uygunolsadaherkesiçinuygunbirseçenekolmayabilir.

Bukullanmatalimatındabelirtilenhastalıklardanveyariskfaktörlerindenherhangibirine

sahipseniz,doktorunuzubilgilendirin.

DIANE35kullanmayabaşlamadanöncedikkatedilmesigerekenler

DIANE35’ialmayabaşlamadanöncedoktorunuzsizinveyakınakrabalarınızınsağlık

geçmişihakkındabazısorularsoracaktır.Doktorunuzaynızamandatansiyonunuzuölçecektir

vegebeolmaolasılığınızıkontroledecektir.Mememuayenesigibibaşkakontrollerde

yapılmasıgerekebilir,ancakbunlaryalnızcagerekliyseveözelbirtakımdurumlarsöz

konusuylayapılır.

DIANE35kullanırken

DoktorunuzgenelliklediğerbirDIANE35reçetesigerektiğindedüzenlikontroller

yaptırmanızıisteyecektir.

Düzenliolarakservikalsmear testi(rahimağzıkansertaramatesti)yaptırmaya

gitmelisiniz.

Heraydeğişiklikolupolmadığınıanlamakiçinmemeuçlarınızıvememelerinizikontrol

ediniz,cildinizdeçukurlaşmaveyayumrugibituhafbirşeyfarkettiğiniztakdirde

doktorunuzusöyleyiniz.

KantetkikiyapılmasıgerektiğindedoktorunuzaveyalaboratuvarpersonelineDIANE35

kullandığınızıbildiriniz,çünkübutipilaçlarbazıtestlerinsonucunuetkileyebilmektedir.

Birameliyatgeçirmenizgerektiğinde,doktorunuzunbuhapıkullandığınızıbilmesi

gerekir.Operasyondan4ila6haftakadarönceDIANE35kullanımınıbırakmanız

gerekebilir.Bununnedenikanpıhtısıriskiniazaltmaktır.DoktorunuzDIANE35’i

yenidennezamankullanmayabaşlayabileceğinizisizesöyleyecektir.

DIANE35kullanmayıbırakmanızgerekirse,eğerdoğumkontrolüiçinDIANE35'ye

güveniyoriseniz,diğerbirdoğumkontrolyöntemi(örn.kondom)kullanmayı

unutmayınız.

Doktorunuzadanışmanızıgerektirendurumlar

Kanpıhtısıylailgiliolasıbirbelirtiylekarşılaşırsanız,ilacıbırakınızvederhal

doktorunuzlagörüşünüz.Bubelirtiler“Kanpıhtıları(Tromboz)”başlığıaltındave“4.

OlasıYanEtkilerNelerdir?”bölümündeaçıklanmaktadır.

DIANE35aynızamandadoğumkontrolhapıolarakdaetkigösterir.Sizinvedoktorunuzun

normaldeoralhormonaldoğumkontrolhaplarınıngüvenlikullanımıiçingeçerliolantüm

hususlarıdikkatealmasıgerekir.

Kanpıhtıları(Tromboz)

DIANE35kanpıhtısıoluşumriskiniziartırabilir.DIANE35kullanıyorolmanızkanpıhtısı

gelişmeriskiniDIANE35veyaherhangibirdoğumkontrolhapıkullanmayankadınlara

kıyaslayalnızcahafiforandaartırabilir.Herzamantamiyileşmesağlanamayabilirve

olguların%1-2'siölümcülolabilir.

Toplardamariçikanpıhtıları

Birtoplardamardakanpıhtısıgelişmesi(venöztrombozolarakbilinir)damarıntıkanmasına

nedenolabilir.Budurumbacak,akciğer(akciğerembolisi)veyaherhangibirdiğerorgandaki

birdamardameydanagelebilir.

Kombinehapkullanımı,kadınlardabutippıhtıgelişmesineilişkinriskiherhangibirkombine

hapkullanmayankadınlarakıyaslaartırır.Birdamariçindekanpıhtısıgelişmeriskininen

yüksekolduğudönemhapınkullanılmayabaşlandığıilkyıldır.Sözkonusurisk,gebelik

sırasındakanpıhtısıgelişmesineilişkinriskkadaryüksekdeğildir.

KanpıhtısıgelişmesineilişkinriskDIANE35kullandığınızdayalnızcabirazartar.

DIANE35kullanmayanvedoğumkontrolhapıalmayanvegebeolmayan100.000

kadındanyaklaşık5ila10'undabiryıliçindekanpıhtısıoluşacaktır.

DIANE35kullananveyadoğumkontrolhapıalan100.000kadındanyaklaşık40'undabir

yıliçindekanpıhtısıoluşacaktır.

Gebeolan100.000kadındanyaklaşık60'ındabiryıliçerisindekanpıhtısıoluşacaktır.

Kombinehapkullananlardadamariçindekanpıhtısıoluşmasınailişkinriskaşağıdakilerle

birliktedahadaartar:

lerleyenyaş;

Sigarakullanımı.

35yaşındanbüyükseniz,DIANE35gibibirdoğumkontrolhapıkullanırkensigarayı

bırakmanızönemletavsiyeedilir

Yakınbirakrabanızdagençyaştabacak,akciğerveyadiğerbirorgandakanpıhtısı

olduysa;

Aşırıkiloluysanız;

Operasyongeçirmenizgerektiğindeveyayaralanmayadahastalıknedeniyleayaklarınızı

uzunsüreyerebasmayacaksanızveyabacağınızalçıdaysa;

Polikistikoversendromunuz(yumurtalıklardaoluşankistler)varsa;

Yakınzamandadoğumyaptıysanız;

Sistemiklupuseritematozus(eklemağrılarıvederidöküntülerinesebepolanbir

hastalık),CrohnHastalığı(kronikiltihabibağırsakhastalığı)veyaülseratifkolit(kalın

barsağıniltihaplıbirhastalığı)gibibirtakımnadirtıbbisorunlarınızvarsa;

Orakhücrelianemi(kalıtsalkanhastalığı)hastasıysanız

Bunlardanherhangibirisiziniçingeçerliysetedavinizinkesilmesigerekebileceğinden,

DIANE35kullandığınızıdoktorunuzasöylemenizönemlidir.Doktorunuzameliyattanveya

hareketsizkalmanızdanhaftalarönceDIANE35kullanmayıbırakmanızısöyleyebilir.

DoktorunuzayağakalktığınızdanezamanyenidenDIANE35kullanmayabaşlayabileceğinizi

desöyleyecektir.

Atardamariçikanpıhtıları

Biratardamariçindekanpıhtısıoluşmasıciddisorunlarayolaçabilir.Örneğin,kalpteki

atardamarlardanbirindekanpıhtısıoluşmasıkalpkrizineyolaçabilir,bununbeyindeolması

inmeyenedenolabilir.

Kombine hap kullanımı atardamarlarda pıhtı oluşmasına ilişkin riskte artışla

ilişkilendirilmiştir.Buriskaşağıdakidurumlardadahadaartar:

lerleyenyaş;

Sigarakullanımı.35yaşındanbüyükseniz,DIANE35gibibirhormonaldoğumkontrol

hapıkullanırkensigarayıbırakmanızönemletavsiyeedilir

Aşırıkiloluysanız;

Yüksektansiyonunuzvarsa;

Yakınbirakrabanızdagençyaştakalpkriziveyainmegeliştiyse;

Kanınızdakiyağdüzeyiyüksekse(kolesterolveyatrigliseridler);

Migreninizvarsa;

Kalprahatsızlığınızvarsa(kapakhastalığı,ritimbozukluğu);

Polikistikoversendromunuz(yumurtalıklardaoluşankistler)varsa;

Diyabetiniz(şekerhastalığı)varsa;

Sistemiklupuseritematozus(eklemağrılarıvederidöküntülerinesebepolanbirhastalık)

gibibirtakımnadirtıbbisorunlarınızvarsa;

Orakhücrelianemi(kalıtsalkanhastalığı)hastasıysanız.

Kanpıhtılarıylailgilibelirtiler

Aşağıdakilergibikanpıhtısıylailgiliolasıbirbelirtiylekarşılaşırsanız,ilacıkullanmayı

bırakınvederhaldoktorunuzlagörüşünüz:

Alışılmadıkaniöksürük;

Solkolayayılanyadayayılmayanşiddetligöğüsağrısı;

Soluksuzluk;

iddetlenenmigrenyadaalışılmadık,uzunsüren,şiddetlibaşağrısı;

Kısmiveyatamkörlükyadaçiftgörme;

Peltekkonuşmaveyakonuşmabozukluğu;

Duyma,kokualma,tatalmaduyularındaanideğişiklikler;

Başdönmesiveyabayılma;

Vücudunherhangibirbölgesindegüçsüzlükveyauyuşma;

Karınbölgesindeşiddetliağrı;

Bacaklardanbirindeşiddetliağrıveyaşişme.

Kanpıhtısıoluştuktansonra,herzamantamiyileşmeolmayabilir.Nadirenkalıcıciddiyeti

kaybıortayaçıkabilirveyakanpıhtısıölümcülolabilir.

Doğumdanhemensonrakadınlardakanpıhtısıriskiartar,bunedenledoğumdannekadar

sonraDIANE35kullanmayabaşlayabileceğinizidoktorunuzadanışmalısınız.

iddetlidepresyon,şiddetlialerjikreaksiyon,kalıtsalanjiyoödemde(vücutbölgelerinde

işme)kötüleşme,memekanseriveyarahimağzıkanseriyleilgilibelirtileryadaciddi

karaciğer(belirtiveişaretler“4.OlasıYanEtkilerNelerdir?”bölümündeaçıklanmıştır.)

sorunlarıylakarşılaşmanızhalindederhaldoktorunuzadanışmalısınız.

DIANE35vekanser

Yüksekdozkombinedoğumkontrolhaplarıuzunsüreylekullanıldığındayumurtalıkverahim

kanseririskiniazaltıyorolmaklabirlikte,DIANE35gibidüşükdozöstrojen-progesteron

içerendoğumkontrolhaplarınındaaynıkoruyucuetkilerigösteripgöstermediğitamolarak

bilinmemektedir.Bunakarşın,DIANE35kullanımırahimağzıkanserineilişkinriskihafif

derecedeartırıyorgibigörünmektedir;ancakbununnedeniDIANE35'denziyadecinsel

ilişkidekondomkullanılmamasıolabilir.Tümkadınlardüzenliolaraksmeartesti

yaptırmalıdır.

Memekanseriisenizveyaöncedenmemekanseritanısıaldıysanız,DIANE35yadadiğer

doğumkontrolhaplarınıkullanmamalısınız,zirabunlarmemekanseririskinihafifölçüde

artırmaktadır.BuriskDIANE35kullanmayadevamettikçeartarancakbıraktıktansonra

yaklaşık10yıliçerisindenormaledöner.Memekanseri40yaşaltıkadınlardanadir

olduğundan,DIANE35kullananlardaveyayakınzamandakullanmışolanlardafazlameme

kanseriolgusuazdır.Örneğin:

HiçDIANE35kullanmamışolan10.000kadının35yaşınagelenekadarmemekanseri

olmaihtimaliyaklaşık16'dır.

Yirmiliyaşlarınbaşında5yılsüreyleDIANE35veyadoğumkontrolhapıkullanmışolan

10.000kadınınm35yaşınagelenekadarmemekanseriolmaihtimaliyaklaşık17-18'dir.

HiçDIANE35kullanmamışolan10.000kadının45yaşınagelenekadarmemekanseri

olmaihtimaliyaklaşık100'dür.

Otuzluyaşlarınbaşında5yılsüreyleDIANE35veyadoğumkontrolhapıkullanmamış

olan10.000kadınının45yaşınagelenekadarmemekanseriolmaihtimaliyaklaşık110'dur.

Aşağıdakidurumlardamemekanserineilişkinriskdahayüksektir:

Yakınbirakrabanızda(anne,kızkardeşveyabüyükanne)memekanseriöyküsü

Ciddiderecedeaşırıkiloluolma

Memedeçukurlaşma,memeuçlarındadeğişikliklerveyagörünenyadahissedilebilenyumru

gibiherhangibirdeğişiklikfarkedersenizenkısasüredebirdoktorabaşvurun.

DIANE35kullanımısarılıkvekanserolmayankaraciğertümörlerigibikaraciğer

hastalıklarıiledeilişkilendirilmiştirancakbudurumnadirdir.Çoknadirolarak;DIANE35

uzunsürekullanankadınlardabazıkaraciğerkanseritipleriiledeilişkilendirilmiştir.

Midenizdeşiddetliağrıveyacildinizdeyadagözlerinizdesararma(sarılık)meydanagelirse

enkısasüredebirdoktorabaşvurunuz.DIANE35kullanmayıbırakmanızgerekebilir.

Gebeliksırasındaveyaöncekidoğumkontrolhapıkullanımıylakötüleşebilendurumlar:

AşağıdakidurumlarınhemgebelikhemdebirKOKveyaDIANE35gibi

östrojen/progesteronkombinasyonununkullanımıilemeydanageldiğiveyakötüleştiği

bildirilmiştir.Aşağıdakilerinherhangibirininkullanımsırasındameydanagelmesihalinde,

DIANE35’ibırakınız:

Kolestazileilişkilisarılıkve/veyakaşıntı(pruritus)

Safrakesesitaşı

Sistemiklupuseritematozus(eklemağrılarıvederidöküntülerinesebepolanbir

hastalık)

Herpesgestationis(gebeliksırasındasutoplamayabenzerdöküntü)

Otosklerozabağlıişitmekaybı

Orakhücrelianemi(kalıtsalkanhastalığı)

Renaldisfonksiyon(böbrekişlevbozukluğu)

Herediteranjiyoödem(vücutbölgelerindeşişme)

TekbirkadındagebeliksırasındaveyaöncekiKOKyadaDIANE35kullanımı

sırasındakötüleşmegösterdiğibildirilenhertürlüdiğerdurum.

DIANE35bazıhastalıklarınkötüleşmesinenedenolabilir

AşağıdasıralanandurumlarınbirkısmıDIANE35kullanımıylakötüleşebilir.Başkabir

deyişle,siziniçindahaazuygunolduğuanlamınagelebilir.DIANE35'yiyinede

kullanabilirsinizancakdahadikkatliolmanızvedahasıksağlıkkontrolündengeçmeniz

gerekir.

Sizdeveyaailenizdeyüksektansiyongibikalpyadadolaşımlailgilisorunvarsa/olduysa

Sizdeveyaailenizdekanpıhtılaşmasıileilgilisorunvarsa/olduysa

Migreninizvarsa/olduysa

Günümüzdeveyageçmiştedepresyonyaşıyorsanız/yaşadıysanız

Aşırıkilolu(obez)iseniz

Porfiriadıverilenkalıtsalhastalığınızvarsa

Diyabethastasıysanız

Pankreasiltihabınız(pankreatit)varsaveyapankreatitgelişmesineilişkinriski

artırabileceğiiçin,sizdeyadaailenizdekandakiyağdüzeyininyüksekolması

(hipertrigliseridemi)ileilgiliöyküsözkonusuise

Yüzünüzdeveyavücudunuzdakahverengilekelenmeler(kloazma)varsa(bkz."DIANE

35vesolaryumlarilebronzlaşmacihazları")

GebeliksırasındaveyaöncedendoğumkontrolhapıyadaDIANE35kullanırken

kötüleşenbirhastalığınızvarsa(bkz.Bölüm“4.OlasıYanEtkilerNelerdir?”)

Budurumlardanherhangibirininsiziniçingeçerliisedoktorunuzasöyleyiniz.AyrıcaDIANE

35kullanmayıbırakmanızgerekebileceğinden,budurumlardanherhangibirinibuilacı

kullanırkenilkkezyaşadıysanızveyabudurumlarkötüleşmişyadatekrarlamışise

doktorunuzabelirtmenizgerekir.

DIANE35vesolaryumlarilebronzlaşmacihazları

Bazıkadınlaraknelerdenkurtulmakveyabronzlaşmakiçinsolaryumkullanır.Bu,akneiçin

pekfaydalıbirtedaviyöntemideğildir.DIANE35kullanırkensolaryumagirmeyinveya

bronzlaşmacihazıkullanmayınveuzunsüregüneşlenmektenkaçının.Bunlarınkullanımı

cilttelekelenmeşeklinderenkdeğişikliğinenedenolankloazmariskiniartırır(normaldoğum

kontrolhaplarıdaburiskiartırır).

Adetperiyotlarındadeğişiklikler

Adetkanamasınınazalması:Budurumolağandışıdeğildirvebazıkadınlardaolmasıbeklenir.

Adetkanmamasınınolmaması:Bazenadetkanamasıhiçolmaz.Drajelerdoğruolarak

alındıysahamilelikmuhtemeldeğildir.Çekilmekanamasındaaksamadrajeyearaverilen

dönemdegerçekleşirse,gebeolmaihtimalinizekarşındoktorunuzadanışınız.

Periyotlararasındakanama:Düzensizkanama(lekelenmeveyaarakanama)özellikle

kullanımınilkaylarındaortayaçıkabilir.Bunedenle,düzensizkanamalarınoluşumuancak

yaklaşıküçdöngüsürenadaptasyondönemindensonraönemkazanmaktadır.Önceden

düzenliolandöngülersonrasındakanamadüzensizlikleriortayaçıktığıveyavarolan

düzensizliklerdevamettiğitakdirdedokturunuzadanışınız.

DIANE35kesildiktensonrabazıkadınlardaözellikleöncedenbutipsorunlarıolanlarda

amenore(adetgörememe)veyaoligomenore(adetgecikmesi)gelişebilir.

Buuyarılargeçmiştekiherhangibirdönemdedahiolsasiziniçingeçerliyselütfen

doktorunuzadanışınız.

DIANE35’inyiyecekveiçecekilekullanılması

DIANE35kullanımısırasındayiyecekveiçeceklerhakkındaherhangiözelbirtalimatyoktur.

Hamilelik

İ lacıkullanmadanöncedoktorunuzaveyaeczacınızadanışınız.

DIANE35,hamileliktekullanılmamalıdır.DIANE35kullanımısırasındahamilelikmeydana

gelirsekullanımdurdurulmalıdır.Hamileolduğunuzdanşüpheleniyorsanız,DIANE35,

kullanmayıbırakmadanöncehamileliktestiyaparakdurumdaneminolun.

Tedavinizsırasındahamileolduğunuzufarkedersenizhemendoktorunuzadanışınız.

Emzirme

DIANE35,emzirirkenkullanılmamalıdır.

İ lacıkullanmadanöncedoktorunuzaveyaeczacınızadanışınız.

Araçvemakinekullanımı

DIANE35kullanımınınaraçvemakinekullanmabecerileriüzerindeherhangibiretkisi

yoktur

DIANE 35’iniçeriğindebulunanbazıyardımcımaddelerhakkındaönemlibilgiler

DIANE35,laktozvesukroziçermektedir.Eğerdahaöncedendoktorunuztarafındanbazı

ekerlerekarşıtahammülsüzlüğünüz(intoleransınız)olduğusöylenmişsebutıbbiürünü

almadanöncedoktorunuzadanışınız.

Diğerilaçlarilebirliktekullanım

DIANE35kullanırkenaynızamandabaşkabirilaçdahaalmanızgerektiğinde,doktorunuza,

eczacınızaveyadişhekiminizeDIANE35kullandığınızımutlakasöyleyiniz.Ayrıca,

hormonaldoğumkontrolhaplarıylabirliktealınıpalınamadığınıöğrenmekiçinilaçlarınızla

birlikteverilenkullanmatalimatlarınıdakontroledin.

CiltleilgilibirtedaviiçinDIANE35kullanıyorsanız,aynızamandadiğerbirhormonal

doğumkontrolhapıkullanmamalısınız.

BazıilaçlarkandakiDIANE35düzeyinietkileyebilirvenormaletkigöstermesini

engelleyebilir,örneğin:

Epilepsitedavisindekullanılanbazıilaçlar

HIVveHepatitCVirüsüenfeksiyonlarınıntedavisindekullanılanbazıilaçlar(proteaz

inhibitörlerivenon-nükleozidterstranskriptazinhibitörleri)

Griseofulvin(birmantarilacı)

Bazıantibiyotikler(oraltetrasiklinler,rifampisin)

Bazıyatıştırıcılar(barbitüratlar)

St.John’sWort(Sarıkantaronotu,bitkiselbirilaç).

BuilaçlardanherhangibirinikullanmanızgerekiyorsaDIANE35siziniçinuygunolmayabilir

yadabirsüreilavebirdoğumkontrolyöntemikullanmanızgerekebilir.Böylebirdurum

gerektiğindevesüresininnekadarolacağıkonusundadoktorunuz,eczacınızveyadiş

hekiminizsizibilgilendirecektir.

DIANE35dediğerilaçlarınetkisinideğiştirebilir.Doktorunuzundiğerilacındozunu

ayarlamasıgerekebilir.

AyrıcaDIANE35bazıkantetkiklerininsonuçlarınıetkileyebilir;bunedenle,kantetkik

yaptırdığınızdaDIANE35kullanmaktaolduğunuzudoktorunuzamutlakasöylemelisiniz.

Eğerreçeteliyadareçetesizherhangibirilacışuandakullanıyorsanızveyasonzamanlarda

kullandınıziselütfendoktorunuzaveyaeczacınızabunlarhakkındabilgiveriniz.

3.DIANE35nasılkullanılır?

Uygunkullanımvedoz/uygulamasıklığıiçintalimatlar:

Doktorunuzyüzünüzdekiveyavücudunuzdakiakneyadaaşırıkıllanmaiçintedaviolarak

DIANE35'iseçmiştir.Bununlabirlikte,DIANE35doğumkontroletkisidegösterdiğinden,

doğumkontroliçinDIANE35'egüveniyorsanız,aşağıdakitavsiyeleridikkatealmanız

önemlidir.

DIANE35'isadeceakneveaşırıkıllanmaiçinkullanıyorsanızdabutavsiyeyeuyabilirsiniz,

ancakemindeğilsenizdoktorunuzadanışınız.

21günboyuncahergünDIANE35kullanın.

DIANE35,herbirindehaftanınbirgünüişaretlenmişolan21drajedenoluşanblisterhalinde

sunulur.

Drajelerihergünaynısaattealın.

Haftanındoğrugünününişaretlendiğidrajeyialarakbaşlayın.

Blisterüzerindekiokyönünütakipedin.21hapıntamamıbitenekadarhergünbirdraje

alın.

Herdrajeyibütünolarakyutun;istersenizsuylabirlikteiçebilirsiniz.Drajeyi

çiğnemeyiniz.

Sonrayedigündrajeyearaverin.

Blisterdeki21drajenintamamınıaldıktansonra,drajealımınayedigünaraverin.Blisterdeki

sondrajeyialdıktanbirkaçgünsonra,adetkanamasınabenzerbirçekilmekanamasıolması

gerekir.Bukanamabirsonrakipaketebaşlamanızgerekenzamandakesilmemişolabilir.

Gebeliğiönlemekiçinbuilacagüveniyorsanız,DIANE35'iherzamanburadabelirtildiği

ekildekullanın.Drajeleridoğruşekildealdığınızvesonrakipaketezamanındabaşladığınız

sürece,drajealımınaaraverdiğinizyedigünlükdönemdeilavedoğumkontrolyöntemi

kullanmanızagerekyoktur.Eminolmadığınızbirdurumolduğundadoktorunuzadanışınız.

Sekizincigündeyenipaketebaşlayınız.Drajealmadığınızyedigünlüksüredensonrayeni

paketebaşlayın(sekizincigünde)-kanamanızdevamediyorolsadahiböyleyapmalısınız.

Yani,pakettekisondrajeyiCumagünüaldıysanızsonrakipaketinilkdrajesiniizleyen

haftanınCumartesigünüalmanızgerekir.Sonrakipaketemutlakazamanındabaşlayın.

DIANE35'idoğrukullandığınızsürece,heryenipaketehaftanınaynıgününde

başlamanızgerekir.

DIANE35'yeyenibaşlayanlarveyaaraverdiktensonrayenidenbaşlayanlar

lkDIANE35drajesibirsonrakiadetdöneminizinilkgünündealınmalıdır.Buşekilde

başladığınızda,ilkdrajeninalınmasıylabirliktedoğumkontrolübaşlamışolacaktır.

BaşkabirdoğumkontrolhapındanDIANE35'egeçişyapılması

21günlükbirdoğumkontrolhapıkullanıyorsanız:Öncekipaketbittiktensonrakigün

DIANE35'ebaşlayın.İlkdrajeninalınmasıylabirliktedoğumkontrolübaşlamış

olacaktır.İlkDIANE35paketinikullanırkenkanamanızolmayacaktır.İlkpaketin

bitimindensonrakanamabaşlayacaktır.

28günlükbirdoğumkontrolhapıkullanıyorsanız:Sonaktifhapıaldıktansonrakigün

DIANE35kullanmayabaşlayın.İlkdrajeninalınmasıylabirliktedoğumkontrolü

başlamışolacaktır.İlkDIANE35paketininsonunakadarkanamaolmamasıgerekir.

Sadeceprogestojeniçerenbiryöntemdengeçiş:Kanamanınbaşladığıgün,ogün

yalnızcaprogesteroniçerendoğumkontrolhapınıalmışolsanızdahi,DIANE35'e

başlayın.Doğumkontrolühemenbaşlamışolacaktır.

DüşükveyakürtajsonrasıDIANE35'yebaşlama

Gebeliğinilküçayındadüşükyaptıysanızveyakürtajolduysanız,doktorunuzDIANE35

kullanımınahemenbaşlamanızgerektiğinisöyleyebilir.Bununanlamıilkdrajenin

alınmasıylabirliktedoğumkontrolübaşlamışolacağıdır.

Gebeliğinizinilküçayındansonradüşükyaptıysanızveyakürtajolduysanız,doktorunuza

danışınız.Kısabirsüreiçinilavebirdoğumkontrolyöntemi(meselakondom)kullanmanız

gerekebilir.

Doğumdansonradoğumkontrolü

Yenidoğumyaptıysanız,tamamenayağakalkmışolmanızkaydıyla,doktorunuzdoğumdan

21günsonraDIANE35kullanmayabaşlamanızıönerebilir.Adetdöneminibeklemenize

gerekyoktur.DIANE35'yebaşlayanakadarvedrajealdığınızilk7günboyuncakondomgibi

ilavebirdoğumkontrolyöntemikullanmanızgerekecektir.

DIANE35,emzirirkenkullanılmamalıdır.

Uygulamayoluvemetodu:

DIANE35,birmiktarsuilealınmalıdır.

DoktorunuzDIANE35iletedavinizinnekadarsüreceğinisizebildirecektir.

Değişikyaşgrupları:

Çocuklardakullanımı:İlkadetgörmedensonraendikedir.

Yaşlılardakullanımı:Yaşlılardakullanımıyoktur.Menopozdansonraendikedeğildir.

Özelkullanımdurumları:

Karaciğeryetmezliği:DIANE35şiddetlikaraciğerhastalıklarıolankadınlarda

kullanılmamalıdır.

Böbrekyetmezliği:DIANE35böbrekyetmezliğiolanhastalardaözelolarak

araştırılmamıştır.Mevcutverilerbuhastalarıntedavisindebirdeğişiklikyapılmasınıileri

sürmemektedir.

EğerDIANE35’inetkisininçokgüçlüveyazayıfolduğunadairbirizleniminizvarise

doktorunuzveyaeczacınızilekonuşunuz.

KullanmanızgerekendendahafazlaDIANE35kullandıysanız:

Aşırıdozdakullanımındabulantı,kusmaveyahafifvajinalkanamagörülebilir.Eğersizdebu

belirtilervarsadoktorunuzabaşvurunuz.

DIANE35’tenkullanmanızgerekendenfazlasınıkullanmışsanızbirdoktorveyaeczacıile

konuşunuz.

DIANE35’ikullanmayıunutursanız:

Birdrajeninunutulması

Drajeyialmayıunutmanızınüzerinden12saattendahaazzamangeçtiysedrajeyihemenalın.

Sonrakidrajelerideherzamankigibialmayadevamedin.Bu,birgündeikidrajealmak

anlamınagelebilir..Endişelenmeyiniz,korunmanızdaazalmaolmaz.

Drajeyialmayıunutmanızınüzerinden12saattenfazlazamangeçtiyseveyabirdenfazla

drajeyialmayıunuttuysanızgebeliğekarşıkorunmanızdaazalmaolabilir.

Aynıandaikidrajealmanızanlamınagelsebile,sonunuttuğunuzdrajeyihatırlar

hatırlamazalın.Unutmuşolduğunuzdahaöncekidrajeleripakettebırakın.

Sonrakiyedigünboyuncaherzamankigibihergünbirdrajealmayadevamedin.

Buyedigünlüksüreiçindepaketinsonunagelirseniz,yedigünlükaravermedenbir

sonrakipaketedevamedin.İkincipakettekidrajelerbitenekadarbüyükihtimallekanama

meydanagelmeyecektiramaendişelenmeyin.İkincipakettekidrajeleribitirdiysenizve

kanamayoksabaşkabirpaketebaşlamadanöncebirgebeliktestiyapın.

Birdrajeyialmayıunuttuktansonrayedigünboyuncakondomgibiilavebirdoğum

kontrolyöntemikullanın.

lkhaftaiçindepakettenbirveyadahafazladrajekullanmayıunutursanız(1-7gün

içinde)veohaftacinselilişkiyegirdiyseniz,gebeolmaihtimalinizsözkonusuolur.Enkısa

sürededoktorunuzaveyaeczacınızadanışın.

Birpakettekidrajelerdenherhangibirinialmayıunutursanızveilkdrajesizdönemdekanama

olmazsa,gebelikihtimalinidikkatealmalısınız.

Doktorunuzlailetişimegeçinyadabirgebeliktestiyapın.

Yenipaketdrajelerebaşlamadagecikirsenizveyayedigündenfazlaaraverirseniz,gebeliğe

karşıkorumanızolmayabilir.Sonyedigüniçerisindecinselbirleşmeyaşadıysanız,

doktorunuzaveyaeczacınızadanışınız.Ayrıcayedigünsüreyle,kondomgibiekstrabir

doğumkontrolyöntemikullanmanızgerekebilir.

Kayıpdraje

Birdrajeyikaybederseniz,

I.alternatifkaybettiğinizdrajeyerinepaketüzerindekisonhapıalın.Sonradiğertüm

drajelerigerekengünlerindealın.Döngünüznormaldenbirgünkısaolacak,ancakgebeliğe

karşıkorunmanızetkilenmeyecektir.Yedigünlükdrajesizdöneminardından,yenibir

başlangıçgününüzolacaktır(eskisindenbirgünönce)

II.alternatifDöngünüzünbaşlangıçgününüdeğiştirmekistemiyorsanız,fazladanbir

paketinizvarsaopakettenbirhapalabilirsiniz.Sonrageçerlipaketinizdekidiğertümdrajeleri

herzamankigibialın.Başkadrajeleridekaybedebilmeihtimalinizekarşıaçmışolduğunuz

yedekpaketisaklayabilirsiniz.

Hastaveyaishalolduğunuzda

Hastaysanız(kusmanızvarsa)veyaağırishalinizvarsa,vücudunuziçtiğinizdrajedenher

zamankidozualamayabilir.DIANE35aldıktan12saatsonradahaiyihissediyorsanız,

Kayıpdraje”bölümündekitalimatlarıizleyinvebirbaşkadrajealın.

DIANE35aldıktan12saattenuzunbirsüresonrahalenhastaysanızveyaishalinizdevam

ediyorsa,“Birdrajeninunutulması”bölümünebakınız.

Midebozukluğunuzdevamederseveyakötüleşirsedoktorunuzasöyleyin.Doktorunuzfarklı

birdoğumkontrolyöntemikullanmanızıönerebilir.

Biradetkanamasınınatlanması–gebeolabilirmisiniz?

Bazençekilmekanamasımeydanagelmeyebilir.Budurum,gebeolabileceğinizanlamına

gelebilsede,drajeleridoğruşekildekullandıysanızgenelliklepekolasıdeğildir.Birsonraki

paketinizenormalzamanındabaşlayın.Gebekalmariskinizolduğunudüşünüyorsanız

(örneğin,drajealmayıunuttuysanızveyabaşkailaçlarkullandıysanız)yadaikincikanamada

olmamışsa,gebeliktestiyapmanızgerekir.Butestlerieczanedensatınalabilirveya

doktorunuzabaşvurabilirsiniz.GebeysenizDIANE35almayıbırakınızvedoktorunuza

başvurunuz.

DIANE35iletedavisonlandırıldığındaoluşabileceketkiler

DIANE ’ yidilediğinizherzamanbırakabilirsiniz.

4.OlasıYanEtkilerNelerdir?

Tümilaçlargibi,DIANE35’iniçeriğindebulunanmaddelereduyarlıolankişilerdeyanetkiler

olabilir.

laçkullanımıylailişkiliciddireaksiyonlardahilyanetkileriçinayrıca‘DIANE35’i

aşağıdakidurumlardaKULLANMAYINIZveDIANE35’iaşağıdakidurumlarda

DİKKATLİKULLANINIZ’bölümlerinebakınız.Bubölümleridikkatleokuyunuzve

gerekirsederhaldoktorunuzabaşvurunuz.

DİANE35kullanantümkadınlardatromboembolizmriskiartmaktadır.

Aşağıdakilerdenherhangibirinifarkederseniz,hemendoktorunuzabildirinizveyasize

enyakınhastaneninacilbölümünebaşvurunuz:

iddetlidepresyon:

DIANE35'nindoğrudanbiryanetkisiolarakkabuledilmemeklebirlikte,bazıkadınlarda

DIANE35kullanımısırasındadepresyonbildirilmiştir.Çoknadirolarak,budurumkişinin

yaşamınasonvermedüşüncesiyleilişkilendirilmiştir.Şiddetlidepresyongelişmesihalinde,

önlemolarakDIANE35kullanmayıbırakmalıvederhaldoktoruzunlagörüşmelisiniz

Kanpıhtısıbulguları:

Alışılmadıkaniöksürük;

Solkolayayılanyadayayılmayanşiddetligöğüsağrısı;

Soluksuzluk;

iddetlenenmigrenyadaalışılmadık,uzunsüren,şiddetlibaşağrısı;

Kısmiveyatamkörlükyadaçiftgörme;

Peltekkonuşmaveyakonuşmabozukluğu;

Duyma,kokualma,tatalmaduyularındaanideğişiklikler;

Başdönmesiveyabayılma;

Vücudunherhangibirbölgesindegüçsüzlükveyauyuşma;

Karınbölgesindeşiddetliağrı;

Bacaklardanbirindeşiddetliağrıveyaşişme.

Ş iddetlialerjikreaksiyonveyakalıtsalanjiyoödemdekötüleşmeyleilgilibelirtiler:

Ellerde,yüzde,dudaklarda,ağızda,dildeveyaboğazdaşişme.Dilde/boğazdaşişme

olmasıyutmavesolukalmadazorluğanedenolabilir.

Kırmızıkabarıkdöküntü(kurdeşen)vekaşıntı.

Memekanseribelirtileri:

Ciltteçukurlaşma

Memeucundadeğişiklik

Görebildiğinizveyahissedebildiğinizhertürlüyumru

Rahimağzıkanserininbelirtileri:

Kötükokuluve/veyakaniçerenvajinalakıntı

Anormalvajinalkanama

Pelvikağrı

Ağrılıcinselbirleşme.

Ciddikaraciğerbozukluklarınınbelirtileri:

Karındaşiddetliağrı;

Ciltteveyagözlerdesararma(sarılık)

Karaciğeriltihabı(hepatit)

Tümvücuttakaşıntıbaşlaması.

Bunlarınhepsiciddiyanetkilerdir.Aciltıbbimüdahalegerekebilir.

Yanetkileraşağıdakikategorilerdegösterildiğişekildesıralanmıştır:

Çokyaygın:10hastanınenaz1indegörülebilir.

Yaygın:10hastanınbirindenaz,fakat100hastanınbirindenfazlagörülebilir.

Yaygınolmayan:100hastanınbirindenaz,fakat1.000hastanınbirindenfazlagörülebilir.

Seyrek:l.000hastanınbirindenaz,fakat10.000hastanınbirindenfazlagörülebilir.

Çokseyrek:10.000hastanınbirindenazgörülebilir.

Bilinmiyor:Eldekiverilerdentahminedilemiyor.

Yaygın:

Depresifduygudurumu,duygudurumdeğişiklikleri

Başağrısı

Bulantı,karınağrısı

Kilodaartış

Memeağrısı,memehassasiyeti

Yaygınolmayan:

Sıvıtutulumu

Cinselistekazalması

Migren

Kusma,ishal

Döküntü,kurdeşen

Memedebüyüme

Seyrek:

Aşırıduyarlılık

Cinselistekartışı

Toplardamardakanpıhtısı(Tromboembolizm)

Kontaktlensetahammülsüzlük

Bacakvekollardaoluşanağrılışişliklerleseyredendöküntülühastalık(eritema

nodozum),

Ağızdavetümvücuttaderininsutoplamasıilekendinigösterenbirhastalık(eritema

multiforme)

Kilodaazalma

Vajinalakıntı

Memedeakıntı

DIANE35gibiilaçlarıkullanankadınlarda,bölüm‘DIANE35’iaşağıdakidurumlarda

DİKKATLİKULLANINIZ’başlıklıkısımdatartışılanaşağıdakiciddiyanetkiler

bildirilmiştir:

Venöztromboembolikbozukluklar(toplardamarlardakanpıhtısıoluşumusonucu

tıkanma)

Arteryeltromboembolikbozukluklar(atardamarlardakanpıhtısıoluşumusonucu

tıkanma)

nmeler(örn.,geçiciiskemikatak,iskemikinme,hemorajikinme)

Yüksektansiyon(hipertansiyon)

Karaciğertümörleri(iyiveyakötühuylu)

Bildirilendiğeryanetkiler

Adetdönemlerinizarasındakanamavelekelenmebazenilkaylardameydanagelebilir

ancakbudurumgenelliklevücudunuzDIANE35'yealıştıktansonrasonaerer.Budurum

devamederse,yoğunlaşırsaveyayenidenbaşlarsa,doktorunuzlagörüşün.

Kloazma(cilttesarı-kahverengilekelenmeler).BudurumDIANE35aylarcakullanıldığı

takdirdeortayaçıkabilir.Kloazma,güneşışığınave/veyaUVlambalaraçokfazlamaruz

kalmanınönlenmesiyleazaltılabilir.

Hareketbozukluğugelişmesiveyakötüleşmesi

Crohnhastalığı(kronikiltihabibağırsakhastalığı)veyaülseratifkolit(kalınbarsağın

iltihaplıbirhastalığı).

Hipertrigliseridemi( belirlikanyağlarında(trigliseritler)artış) Gebeliksırasındaveya

öncekidoğumkontrolhapıkullanımıylakötüleşebilendurumlar:

deridesararma(sarılık)

kalıcıkaşıntı(pruritus)

böbrekveyakaraciğersorunları

safrakesesitaşı

sistemiklupuseritematozus(eklemağrılarıvederidöküntülerinesebepolanbir

hastalık)

gebeliksırasındasutoplamayabenzerdöküntü(herpesgestastionis)

kalıtsalbirsağırlıkformu(otoskleroz)

orakhücrelianemi(kalıtsalkanhastalığı)yadabirformuileilgiliöyküveyaaile

öyküsü

vücutbölgelerindeşişme(kalıtsalanjiyoödem)

porfiriadıverilenkalıtsalbirhastalık

rahimağzıkanseri

KOKveyaDIANE35kullanankadınlardaglukoztoleransında(şekerinetkisinedayanıklılık)

değişimlerveyaperiferikinsülindirenci(vücuttadolaşaninsülinhormonunakarşıgösterilen

direnç)üzerineetkibildirilmiştir(bkz.bölüm“DIANE35’iaşağıdakidurumlarda

DİKKATLİKULLANINIZ).

DIANE35'denkaynaklandığınıdüşündüğünüzherhangibiryanetkihakkındaendişeleriniz

varsadoktorunuzveyaeczacınızilegörüşün.AyrıcaDIANE35kullanırkenmevcutherhangi

birrahatsızlığınızdakötüleşmeolursadadoktorunuzasöyleyin.

Adetdönemleriarasındakikanamalarınuzunsürmesibeklenmez.

AzsayıdakadındaDIANE35kullandıklarısırada,özellikleilkbirkaçayiçerisindeolmak

üzere,beklenmedikhafifkanamalarveyalekelenmelermeydanagelmiştir.Genellikle,butip

kanamaiçinendişelenilmesigerekmezvebirveyaikigüniçerisindesonaerer.DIANE35'i

herzamankigibikullanmayadevamedin.Sorununilkbirkaçpakettensonradüzelmesi

beklenir.

Ayrıca,drajeleridüzenliolarakalmadığınızdabeklenmedikkanamalarmeydanagelebilir.Bu

nedenledrajelerihergünaynısaattealmayaözengösterin.Ayrıca,beklenmedikkanama

bazendiğerilaçlardandakaynaklanabilir.

Aşağıdakiözellikleresahipanikanamaveyalekelenmeolduğundadoktorunuzabaşvurunuz:

lkbirkaçaydanuzunsüren,

DIANE35'ibirsürekullandıktansonrabaşlayan,

DIANE35kullanmayıbıraktıktansonradevameden.

Eğerbukullanmatalimatındabahsigeçmeyenherhangibiryanetkiilekarşılaşırsanız

doktorunuzuveyaeczacınızıbilgilendiriniz.

Yanetkilerinraporlanması

Kullanmatalimatındayeralanveyaalmayanherhangibiryanetkimeydanagelmesi

durumundahekiminiz,eczacınızveyahemşirenizilekonuşunuz.Ayrıcakarşılaştığınızyan

etkileriwww.titck.gov.trsitesindeyeralan“İlaçYanEtkiBildirimi”ikonunatıklayarakya

da,08003140008numaralıyanetkibildirimhattınıarayarakTürkiyeFarmakovijilans

Merkezi(TÜFAM)’nebildiriniz.Meydanagelenyanetkileribildirerekkullanmakta

olduğunuzilacıngüvenliliğihakkındadahafazlabilgiedinilmesinekatkısağlamış

olacaksınız.

5.DIANE35’inSaklanması

DIANE35’içocuklarıngöremeyeceği,erişemeyeceğiyerlerdeveambalajındasaklayınız.

25°C’ninaltındaodasıcaklığındasaklayınız.

Sonkullanmatarihiyleuyumluolarakkullanınız.

Ambalajdaki/kartondaki/şişedekisonkullanmatarihindensonraDIANE35’ikullanmayınız.

Eğerüründeve/veyaambalajındabozuklukfarkedersenizDIANE35’ikullanmayınız.

RuhsatSahibi: BayerTürkKimyaSan.Ltd.Şti.,

FatihSultanMehmetMah.BalkanCad.No:53

34770Ümraniye-İstanbul

Tel:(0216)5283600

Faks:(0216)6453950

Üretimyeri:BayerWeimarGmbHundCo.KGWeimar-Almanya

Bukullanmatalimatı(gün,ay,yıl)tarihindeonaylanmıştır.

3-11-2018

Janssen Issues Voluntary Nationwide Recall for one lot of ORTHO-NOVUM 1/35 and two lots of ORTHO-NOVUM 7/7/7 Due to Incorrect Veridate Dispenser Instructions

Janssen Issues Voluntary Nationwide Recall for one lot of ORTHO-NOVUM 1/35 and two lots of ORTHO-NOVUM 7/7/7 Due to Incorrect Veridate Dispenser Instructions

Janssen Pharmaceuticals, Inc. has initiated a voluntary recall of one lot of ORTHO-NOVUM 1/35 (norethindrone / ethinyl estradiol) Tablets and two lots of ORTHO-NOVUM 7/7/7 (norethindrone / ethinyl estradiol) Tablets to the pharmacy level. The patient information provided inside affected packages of ORTHO-NOVUM does not include the appropriate instructions for the Veridate dispenser.

FDA - U.S. Food and Drug Administration

30-10-2018

FDA takes action to stop the use of lead acetate in hair dyes

FDA takes action to stop the use of lead acetate in hair dyes

FDA takes action to stop the use of lead acetate in hair dyes. FDA will no longer allow lead acetate to be used in certain hair coloring products based on data that demonstrate that there is no longer a reasonable certainty of no harm from the use of this color additive.

FDA - U.S. Food and Drug Administration

10-8-2018

FDA approves new vaginal ring for one year of birth control

FDA approves new vaginal ring for one year of birth control

FDA approved Annovera (segesterone acetate and ethinyl estradiol vaginal system), a combined hormonal contraceptive for women of reproductive age used to prevent pregnancy and is the first vaginal ring contraceptive that can be used for an entire year.

FDA - U.S. Food and Drug Administration

29-5-2018

TAYTULLA (norethindrone acetate and ethinyl estradiol capsules and ferrous fumarate capsules) by Allergan: Recall - Due to Out of Sequence Capsules

TAYTULLA (norethindrone acetate and ethinyl estradiol capsules and ferrous fumarate capsules) by Allergan: Recall - Due to Out of Sequence Capsules

Allergan recently identified, through a physician report, that four placebo capsules were placed out of order in a sample pack of TAYTULLA. Specifically, the first four days of therapy had four non-hormonal placebo capsules instead of active capsules. As a result of this packaging error, oral contraceptive capsules, that are taken out of sequence, may place the user at risk for contraceptive failure and unintended pregnancy. The reversing of the order may not be apparent to either new users or previous ...

FDA - U.S. Food and Drug Administration

29-5-2018

Allergan Issues Nationwide Voluntary Recall of TAYTULLA® Softgel Capsules 1mg/20mcg Sample Packs Due to Out of Sequence Capsules

Allergan Issues Nationwide Voluntary Recall of TAYTULLA® Softgel Capsules 1mg/20mcg Sample Packs Due to Out of Sequence Capsules

Allergan plc (NYSE:AGN) today issued a voluntary recall in the US market of one lot (Lot# 5620706, Expiry May-2019) of TAYTULLA® (norethindrone acetate and ethinyl estradiol capsules and ferrous fumarate capsules) 1mg/20mcg, 6x28 physicians sample pack, indicated for use by women to prevent pregnancy. Allergan recently identified, through a physician report, that four placebo capsules were placed out of order in a sample pack of TAYTULLA. Specifically, the first four days of therapy had four non-hormonal...

FDA - U.S. Food and Drug Administration