Lesamor 80 mg/25 mg Tablett

Sverige - svenska - Läkemedelsverket (Medical Products Agency)

Bipacksedel Bipacksedel (PIL)

22-05-2015

Produktens egenskaper Produktens egenskaper (SPC)

22-05-2015

Aktiva substanser:
hydroklortiazid; telmisartan
Tillgänglig från:
STADA Arzneimittel AG
ATC-kod:
C09DA07
INN (International namn):
hydrochlorothiazide; telmisartan
Dos:
80 mg/25 mg
Läkemedelsform:
Tablett
Sammansättning:
hydroklortiazid 25 mg Aktiv substans; telmisartan 80 mg Aktiv substans; mannitol Hjälpämne
Klass:
Apotek
Receptbelagda typ:
Receptbelagt
Terapiområde:
Telmisartan och diuretika
Bemyndigande status:
Avregistrerad
Godkännandenummer:
48999
Tillstånd datum:
2013-12-16

Läs hela dokumentet

Läkemedelsverket2015-05-22

Bipacksedel: Information till användaren

Lesamor 40 mg/12,5 mg tabletter

Lesamor 80 mg/12,5 mg tabletter

Lesamor 80 mg/25 mg tabletter

Telmisartan/hydroklortiazid

Läs noga igenom denna bipacksedel innan du börjar ta detta läkemedel. Den innehåller information 

som är viktig för dig.

Spara denna information, du kan behöva läsa den igen.

Om du har ytterligare frågor vänd dig till läkare eller apotekspersonal.

Detta läkemedel har ordinerats enbart åt dig. Ge det inte till andra. Det kan skada 

dem, även om de uppvisar sjukdomstecken som liknar dina.

Om du får biverkningar, tala med läkare eller apotekspersonal.   Detta gäller   även  

eventuella biverkningar som inte nämns i denna information. Se avsnitt 4.

I denna bipacksedel finns information om följande:

Vad Lesamor är och vad det används för

Vad du behöver veta innan du tar  Lesamor

Hur du tar Lesamor

Eventuella biverkningar

Hur Lesamor ska förvaras

Förpackningens innehåll och övriga upplysningar

1. Vad Lesamor är och vad det används för

Lesamor är en kombination av två aktiva ämnen, telmisartan och hydroklortiazid i en 

tablett. Båda dessa ämnen hjälper till att kontrollera högt blodtryck.

­Telmisartan tillhör en grupp läkemedel, som kallas angiotensin­II­hämmare. 

Angiotensin II är ett kroppseget ämne som gör att dina blodkärl blir trängre vilket i sin 

tur leder till att ditt blodtryck stiger. Telmisartan blockerar den här effekten av 

angiotensin II, vilket leder till att blodkärlen vidgas och blodtrycket sänks.

­Hydroklortiazid hör till en grupp läkemedel som kallas tiaziddiuretika som orsakar 

ökad urinutsöndring, vilket även leder till en sänkning av ditt blodtryck.

Högt blodtryck som inte behandlas kan orsaka kärlskador i flera organ, som i vissa fall kan 

leda till hjärtattack, hjärtsvikt, njursvikt, stroke eller blindhet. Oftast ger högt blodtryck inga 

symptom innan skadorna uppträder. Det är därför viktigt att regelbundet mäta blodtrycket 

för att bekräfta att det är normalt.

För styrkorna 40 mg/12,5 mg och 80 mg/12,5 mg:

Lesamor används för att behandla högt blodtryck (essentiell hypertoni) hos vuxna vars 

blodtryck inte kontrolleras tillräckligt när enbart telmisartan används.

För styrkan 80 mg/25 mg:

Lesamoranvändsförattbehandlahögtblodtryck(essentiellhypertoni)hosvuxnavarsblodtryck

intekan kontrollerastillräckligtavLesamor80 mg/12,5 mgellertillpatientersomtidigarevarit

stabilapåtelmisartanoch hydroklortiazidgivnavarför sig.

Läkemedelsverket2015-05-22

TelmisartanochhydroklortiazidsomfinnsiLesamorkanocksåvaragodkändförattbehandlaandra

sjukdomarsomintenämnsidennabipacksedel.Frågaläkare,apotekspersonalellerannanhälso-och

sjukvårdspersonalomduharytterligarefrågorochföljalltidderasinstruktion.

2. Vad du behöver veta innan du tar Lesamor

TA INTE Lesamor:

5*om du är allergisk mot telmisartan eller något annat innehållsämne i detta läkemedel 

(anges i avsnitt 6).

6*om du är allergisk mot hydroklortiazid eller mot något sulfonamid­derivat

7*gravida kvinnor ska inte använda Lesamor under de 6 sista månaderna av 

graviditeten. (Även tidigare under graviditeten är det bra att undvika Lesamor, se 

Graviditet och amning).

8*om du har svåra leverproblem såsom gallstas eller gallvägsobstruktion (problem med 

avflöde av galla från levern och gallblåsan) eller någon annan svår leversjukdom

9*om du har en svår njursjukdom

10*om din läkare fastställer att du har låga kaliumnivåer eller höga kalciumnivåer i blodet 

som inte förbättras med behandling.

11*om du har diabetes eller nedsatt njurfunktion och behandlas med ett 

blodtryckssänkande läkemedel som innehåller aliskiren.

Tala om för din läkare eller apotekspersonal innan du tar Lesamor om något av 

ovanstående gäller dig.

Varningar och försiktighet

Tala med din läkare om du har eller har haft något av följande tillstånd eller sjukdomar:

­Lågt blodtryck (hypotoni) som gärna uppstår om du är uttorkad (kraftig förlust av 

kroppsvätska) eller om du har saltbrist på grund av diuretikabehandling 

(vätskedrivande behandling), saltfattig diet, diarré, kräkningar eller hemodialys.

­Njursjukdom eller om du har genomgått en njurtransplantation.

­Njurartärstenos (förträngning på blodkärl som leder till en eller båda njurarna).

­Leversjukdom.

­Hjärtproblem.

­Diabetes.

­Gikt.

­Förhöjda aldosteronhalter (vatten och saltansamling i kroppen tillsammans med 

obalans av olika mineraler i blodet).

­Systemisk lupus erythematosus (även kallad ”lupus” eller ”SLE”) en sjukdom där 

kroppens immunsystem angriper kroppen.

­Den aktiva substansen hydroklortiazid kan orsaka en ovanlig reaktion som orsakar 

försämrad syn och ögonsmärta. Detta kan vara symtom på ett ökat tryck i ditt öga, 

och kan inträffa inom timmar till veckor efter att du tagit Lesamor. Det kan leda till ett 

permanent synnedsättning om tillståndet inte behandlas.

Tala med läkare innan du tar Lesamor:

om du tar digoxin.

om du tar något av följande läkemedel som används för att behandla högt blodtryck:

en ACE­hämmare (till exempel enalapril, lisinopril, ramipril)), särskilt om du har 

diabetesrelaterade njurproblem.

aliskiren

Läkemedelsverket2015-05-22

Din läkare kan behöva kontrollera njurfunktion, blodtryck och mängden elektrolyter (t.ex. 

kalium) i blodet med jämna mellanrum. 

Se även informationen under rubriken ”TA INTE Lesamor”

Om du tror att du är gravid eller blir gravid under behandlingen, kontakta din läkare. 

Lesamor rekommenderas inte under tidig graviditet och ska inte användas under de 6 sista 

månaderna av graviditeten, eftersom det då kan orsaka fosterskador (se Graviditet och 

amning).

Behandling med hydroklortiazid kan orsaka störningar i elektrolytbalansen i din kropp. 

Typiska symtom på rubbad vätske­ eller elektrolytbalans är muntorrhet, svaghet, 

orkeslöshet, sömnighet, rastlöshet, muskelsmärta eller kramper, illamående 

(sjukdomskänsla), kräkningar, trötthet i musklerna och onormalt snabb puls (snabbare än 

100 slag per minut). Om du upplever något av dessa symptom ska du tala om det för din 

läkare.

Du ska också tala om för din läkare om du upplever att huden är mer känslig för solljus, 

med symtom som solbränna (som rödhet, klåda, svullnad, blåsor) som utvecklas snabbare 

än normalt.

Om du ska opereras eller sövas, ska du tala om för din läkare att du använder Lesamor.

Lesamor kan vara mindre effektivt vid behandling för att sänka blodtrycket hos färgade 

patienter.

Barn och ungdomar

Användning av Lesamor hos barn och ungdomar upp till 18 år rekommenderas inte.

Andra läkemedel och Lesamor

Tala om för läkare eller apotekspersonal om du tar, nyligen har tagit eller kan tänkas ta 

andra läkemedel. Din läkare kan behöva ändra dosen på de andra läkemedlen eller vidta 

andra åtgärder. I vissa fall kan du behöva sluta ta något av läkemedlen. Detta gäller 

särskilt de läkemedlen listade nedan om de tas samtidigt med Lesamor:

­Litiuminnehållande läkemedel för att behandla vissa typer av depression.

­Läkemedel förknippade med lågt kaliumvärde i blodet (hypokalemi) såsom diuretika 

(vätskedrivande läkemedel), laxermedel (t ex ricinolja), kortikosteroider (t ex 

prednison), ACTH (ett hormon), amfotericin (ett svampdödande medel), carbenoxolon 

(används vid behandling av munsår), penicillin­G­natrium (ett antibiotikum), 

salicylsyra och derivat.

­Kaliumsparande diuretika, kaliumtillskott, saltersättningsmedel som innehåller kalium, 

ACE­hämmare som kan höja kaliumnivåerna i blodet.

­Hjärtmediciner (t ex digoxin) eller läkemedel som kontrollerar din hjärtrytm (t ex 

kinidin, disopyramid).

­Läkemedel som används vid psykiska sjukdomar (t ex tioridazin, klorpromazin, 

levomepromazin).

­Andra läkemedel som används för att behandla högt blodtryck, steroider, 

smärtstillande läkemedel, läkemedel för att behandla cancer, gikt eller artrit och 

vitamin­D­tillskott.

­Digoxin.

Din läkare kan behöva ändra din dos och/eller vidta andra försiktighetsåtgärder: 

Om du tar en ACE­hämmare eller aliskiren (se även informationen under rubrikerna ”TA 

INTE Lesamor” och ”Varningar och försiktighet”)

Läkemedelsverket2015-05-22

Lesamor kan öka den blodtryckssänkande effekten av andra läkemedel, eller läkemedel 

som kan sänka blodtrycket (t.ex. baklofen, amifostin). Dessutom kan lågt blodtryck 

förvärras av alkohol, barbiturater, narkotika och antidepressiva läkemedel. Du kan märka 

det som yrsel när du står upp. Du ska därför rådfråga din läkare om du behöver ändra 

dosen på något av dina andra läkemedel när du tar Lesamor.

Effekten av Lesamor kan reduceras när du tar NSAID (icke­steroida antiinflammatoriska 

läkemedel, t ex acetylsalicylsyra och ibuprofen).

Graviditet, amning och fertilitet

Graviditet

Om du tror att du är gravid eller blir gravid under behandlingen, kontakta din läkare. 

Vanligtvis föreslår din läkare att du ska sluta ta Lesamor före graviditet eller så snart du vet 

att du är gravid och istället rekommendera ett annat läkemedel till dig. Lesamor bör inte 

användas under tidig graviditeten och ska inte användas under de 6 sista månaderna 

eftersom det då kan orsaka fosterskador.

Amning

Berätta för din läkare om du ammar eller tänker börja amma. Lesamor rekommenderas 

inte vid amning och din läkare kan välja en annan behandling till dig om du vill amma ditt 

barn, särskilt om ditt barn är nyfött eller föddes för tidigt.

Körförmåga och användning av maskiner

Vissa personer känner sig yra eller trötta när de tagit Lesamor. Om du känner dig yr eller 

trött ska du inte framföra fordon eller använda maskiner.

Du är själv ansvarig för att bedöma om du är i kondition att framföra motorfordon eller 

utföra arbeten som kräver skärpt uppmärksamhet. En av faktorerna som kan påverka din 

förmåga i dessa avseenden är användning av läkemedel på grund av deras effekter 

och/eller biverkningar. Beskrivning av dessa effekter och biverkningar finns i andra avsnitt. 

Läs därför all information i denna bipacksedel för vägledning. Diskutera med din läkare 

eller apotekspersonal om du är osäker.

3. Hur du tar Lesamor

Ta alltid detta läkemedel enligt läkarens eller apotekspersonalens anvisningar. Rådfråga 

läkare eller apotekspersonal om du är osäker.

Rekommenderad dos av Lesamor är en tablett per dag. Försök att ta tabletten vid samma 

tidpunkt varje dag. Du kan ta Lesamor med eller utan föda. Tabletterna ska sväljas ned 

med lite vatten eller någon annan alkoholfri dryck. Det är viktigt att fortsätta ta Lesamor 

varje dag tills läkaren ger annat besked. 

Om din lever inte fungerar ordentligt bör normaldosen inte överstiga 40 mg/12,5 mg en 

gång dagligen.

Om du har tagit för stor mängd av Lesmor

Om du har fått i dig för stor mängd läkemedel eller om t.ex. ett barn har fått i sig 

läkemedlet av misstag kontakta läkare, sjukhus eller Giftinformationscentralen (tel. 112) för 

bedömning av risken samt rådgivning. Gör detta även om du/barnet inte märker några 

symtom. 

Om du har glömt att ta Lesamor

Läkemedelsverket2015-05-22

Bli inte orolig om du glömmer att ta en dos. Ta dosen så snart du kommer ihåg det och 

fortsätt sedan som förut. Om du glömmer medicinen en dag ska du ta den vanliga dosen 

nästa dag. Ta inte dubbel dos för att kompensera för glömd dos.

Om du har ytterligare frågor om detta läkemedel, kontakta läkare eller apotekspersonal.

4. Eventuella biverkningar

Liksom alla läkemedel kan detta läkemedel orsaka biverkningar, men alla användare 

behöver inte få dem.

Vissa biverkningar kan vara allvarliga och kräva omedelbar medicinsk behandling.

Kontakta läkare omedelbart om du upplever något av följande symtom:

Sepsis* (som ofta kallas ”blodförgiftning”), är en svår infektion med inflammatoriska 

reaktioner i hela kroppen, hastig svullnad av hud och slemhinnor (angioödem). Dessa 

biverkningar är sällsynta (kan förekomma hos upp till 1 av 1 000 användare) men extremt 

allvarliga och patienter ska sluta ta läkemedlet och omedelbart uppsöka läkare. Tillstånden 

kan vara dödliga om de inte behandlas. Ökad förekomst av sepsis har observerats med 

enbart telmisartan, men kan dock inte uteslutas för Lesamor.

Tänkbara biverkningar av Lesamor:

Vanliga biverkningar (kan förekomma hos upp till 1 av 10 användare):

Yrsel

Mindre vanliga biverkningar (kan förekomma hos upp till 1 av 100 användare):

Minskande kaliumvärden, oro, svimning (synkopé), upplevelse av domningar, stickningar 

(parastesier), svindel (vertigo), snabb hjärtrytm (takykardi), hjärtrytmrubbningar, lågt 

blodtryck, plötsligt blodtrycksfall när du reser dig upp, andningssvårigheter (dyspné), 

diarré, muntorrhet, väderspänning, ryggsmärta, muskelspasmer, muskelvärk, erektil 

dysfunktion (oförmåga att få eller bibehålla erektion), bröstsmärta, ökad urinsyranivå i 

blodet.

Sällsynta biverkningar (kan förekomma hos upp till 1 av 1 000 användare):

Inflammation i lungorna (bronkit), aktivering eller försämring av systemisk lupus 

erythematosus (en sjukdom där kroppens immunförsvar angriper den egna kroppen vilket 

orsakar ledsmärta, hudutslag och feber), halsont, inflammerade bihålor, nedstämdhet 

(depression), sömnsvårigheter (insomnia), nedsatt syn, andningssvårigheter, magsmärta, 

förstoppning, uppkördhet (dyspepsi), illamående, inflammation i magen (gastrit), avvikande 

leverfunktion (japanska patienter löper större risk att få den biverkan), hastig svullnad av 

huden och slemhinnor vilket även kan leda till döden (angioödem även med dödlig 

utgång), rodnad av huden (erytem), allergiska reaktioner som klåda eller utslag; ökad 

svettning, nässelutslag (urtikaria), ledvärk (artralgi) och smärta i armar och ben, 

muskelkramper, influensalik sjukdom, smärta, ökade nivåer av urinsyra i blodet, låga 

nivåer av natrium i blodet, ökade nivåer av kreatinin, leverenzymer eller kreatinfosfokinas i 

blodet.

Biverkningar som rapporterats för en av de enskilda komponenterna, kan vara en möjlig 

biverkan med Lesamor, även om de inte observerats i kliniska studier med detta 

läkemedel.

Telmisartan

Hos patienter som enbart använder telmisartan har dessutom följande biverkningar 

rapporterats:

Läkemedelsverket2015-05-22

Mindre vanliga biverkningar (kan förekomma hos upp till 1 av 100 användare):

Övre luftvägsinfektion (till exempel halsont, inflammerade bihålor, vanlig förkylning), 

urinvägsinfektioner, brist på röda blodkroppar (anemi), höga kaliumnivåer, långsam 

hjärtrytm (bradykardi), nedsatt njurfunktion inklusive akut njursvikt, svaghet, hosta.

Sällsynta biverkningar (kan förekomma hos upp till 1 av 1000 användare):

Sepsis* (som ofta kallas ”blodförgiftning” är en svår infektion med inflammatoriska 

reaktioner i hela kroppen som kan leda till döden), lågt antal blodplättar (trombocytopeni), 

ökning av vissa vita blodkroppar (eosinofili), allvarliga allergiska reaktioner (till exempel 

överkänslighet, anafylaktisk reaktion, läkemedelsutslag), låg blodsockerhalt (hos patienter 

med diabetes), orolig mage, eksem (en hudsjukdom), artros, seninflammation, minskade 

hemoglobinnivåer (ett protein i blodet), somnolens.

Mycket sällsynta biverkningar (kan förekomma hos upp till 1 av 10 000 användare):

Progressiv ärrbildning i lungvävnad (interstitiell lungsjukdom)**

* Dessa biverkningar kan vara en tillfällighet eller ha samband med en mekanism som för 

närvarande inte är känd.

** Det har rapporterats fall av progressiv ärrbildning i lungvävnad vid behandling med 

telmisartan. Man vet dock inte om telmisartan är orsaken.

Hydroklortiazid

Hos patienter som enbart använder hydroklortiazid har dessutom följande biverkningar 

rapporterats:

Biverkningar utan känd frekvens (frekvens kan inte beräknas från tillgängliga data):

Inflammation i salivkörtel, minskat antal blodkroppar, inklusive lågt antal röda och vita 

blodkroppar, lågt antal blodplättar (trombocytopeni), allvarliga allergiska reaktioner (t ex 

överkänslighet, anafylaktiska reaktioner), minskad aptit eller aptitlöshet, rastlöshet, yrsel, 

dimsyn eller gulfärgat synfält, försämrad syn och ögonsmärta (möjliga tecken på akut 

närsynthet eller glaukom med sluten kammarvinkel), inflammation i blodkärl 

(nekrotiserande vaskulit), inflammerad bukspottkörtel, orolig mage, gulnad hud eller 

gulnade ögon (gulsot), lupusliknande syndrom (ett tillstånd liknande en sjukdom kallad 

systemisk lupus erythematosus där kroppens immunförsvar angriper den egna kroppen), 

hudsjukdomar såsom inflammerade blodkärl i huden, ökad känslighet för solljus eller 

blåsor och fjällning på det översta hudlagret (toxisk epidermal nekrolys), svaghet, 

njurinflammation eller försämrad njurfunktion, glykos i urinen (glykosuri), feber, försämrad 

saltbalans (elektrolytbalans), höga blodkolesterolnivåer, minskad blodvolym, ökade nivåer 

av glukos eller fett i blodet.

Rapportering av biverkningar

Om du får biverkningar, tala med läkare eller apotekspersonal.   Detta gäller även 

biverkningar som inte nämns i denna information. Du kan också rapportera biverkningar 

direkt (se detaljer nedan).Genom att rapportera biverkningar kan du bidra till att öka 

informationen om läkemedels säkerhet.

Läkemedelsverket

Box 26

751 03 Uppsala

Webbplats:  www.lakemedelsverket.se

5. Hur Lesamor ska förvaras

Förvara detta läkemedel utom syn­ och räckhåll för barn.

Läkemedelsverket2015-05-22

Används före utgångsdatum som anges på kartongen eller blister efter EXP. 

Utgångsdatumet är den sista dagen i angiven månad.

För Al/Al blister 

Inga särskilda förvaringsanvisningar.

För Al/PVDC Tristar blister:

Förvaras vid högst 30 °C

Läkemedel ska inte kastas i avloppet eller bland hushållsavfall. Fråga apotekspersonalen 

hur man kastar läkemedel som inte längre används. Dessa åtgärder är till för att skydda 

miljön.

6. Förpackningens innehåll och övriga upplysningar

Innehållsdeklaration

De aktiva substanserna är telmisartan och hydroklortiazid. 

40 mg/12,5 mg:

Varje tablett innehåller 40 mg telmisartan och 12,5 mg hydroklortiazid.

80 mg/12,5 mg:

Varje tablett innehåller 80 mg telmisartan och 12,5 mg hydroklortiazid.

80mg/25mg:

Varje tablett innehåller 80 mg telmisartan och 25 mg hydroklortiazid.

Övriga innehållsämnen är magnesiumstearat (E470b), kaliumhydroxid, meglumin, povidon, 

natriumstärkelseglykolat (typ A), mikrokristallin cellulosa, mannitol (E421)

Läkemedlets utseende och förpackningsstorlekar

Lesamor 40 mg/12,5 mg tabletter är vita eller nästan vita, 6,55 x 13,6 mm ovala och 

bikonvexa tabletter präglad med "TH" på ena sidan.

Lesamor 80 mg/12,5 mg tabletter är vita eller nästan vita, 9,0 x 17,0 mm kapselformade 

tabletter präglad med "TH 12.5" på båda sidor.

Lesamor 80 mg/25 mg tabletter är vita eller nästan vita, 9,0 x 17,0 mm kapselformade och 

bikonvexa tabletter präglad med "TH” ena sidan och ”25" på andra sidan.

Förpackningsstorlekar

Blister med: 14, 28, 56 eller 98 tabletter.

Eventuellt kommer inte alla förpackningsstorlekar att marknadsföras.

Innehavare av godkännande för försäljning och tillverkare

STADA Arzneimittel AG

Stadastrasse 2­18,

61118 Bad Vilbel

Tyskland

Kontakta ombudet för innehavaren av godkännandet för försäljning om du vill veta mer om detta 

läkemedel:

Läkemedelsverket2015-05-22

STADA Nordic ApS

Marielundvej 46 A

2730 Herlev

Danmark

Denna bipacksedel ändrades senast 

2015­05­22

Läs hela dokumentet

Läkemedelsverket2015-05-22

PRODUKTRESUMÉ

1. LÄKEMEDLETS NAMN

Lesamor 40 mg/12,5 mg tabletter

Lesamor 80 mg/12,5 mg tabletter

Lesamor 80 mg/25 mg tabletter

2. KVALITATIV OCH KVANTITATIV SAMMANSÄTTNING

Varje tablett innehåller 40 mg telmisartan och 12,5 mg hydroklortiazid.

Varje tablett innehåller 80 mg telmisartan och 12,5 mg hydroklortiazid.

Varje tablett innehåller 80 mg telmisartan och 25 mg hydroklortiazid.

För fullständig förteckning över hjälpämnen, se avsnitt 6.1.

3. LÄKEMEDELSFORM

Tablett.

Lesamor 40 mg/12,5 mg tabletter är vita eller nästan vita, 6,55 x 13,6 mm ovala och 

bikonvexa tabletter präglad med "TH" på ena sidan.

Lesamor 80 mg/12,5 mg tabletter är vita eller nästan vita, 9,0 x 17,0 mm kapselformade 

tabletter präglad med "TH 12.5" på båda sidor.

Lesamor 80 mg/25 mg tabletter är vita eller nästan vita, 9,0 x 17,0 mm kapselformade och 

bikonvexa tabletter präglad med "TH” ena sidan och ”25" på andra sidan.

4. KLINISKA UPPGIFTER

4.1 Terapeutiska indikationer

Behandling av essentiell hypertoni.

Lesamor 40 mg/12,5 mg tabletter och Lesamor 80 mg/12,5 mg är en fast kombination (40 

mg telmisartan/12,5 mg hydroklortiazid och 80 mg telmisartan/12,5 mg hydroklortiazid) 

som är avsedd för vuxna vars blodtryck inte kontrolleras adekvat av telmisartan enbart.

Lesamor 80 mg/25mgtabletter är enfastkombination(80 mgtelmisartan/25 mghydroklortiazid)

somäravseddför vuxnavarsblodtryckintekontrollerasadekvatav Lesamor 80 mg/12,5(80 mg

telmisartan/12,5mghydroklortiazid)eller för patientersomtidigarevaritstabilapåtelmisartanoch

hydroklortiazid givnavar för sig.

4.2Dosering och administreringssätt

Dosering

Lesamor ska tas av patienter vars blodtryck inte kontrolleras adekvat av telmisartan 

enbart. Individuell dostitrering av var och en av de två komponenterna rekommenderas 

före byte till den fasta kombinationen. När det är lämpligt ur klinisk synpunkt kan byte direkt 

från monoterapi till den fasta kombinationen övervägas.

40 mg/12,5 mg och 80 mg/12,5 mg:

Lesamor 40 mg/12,5 mg kan ges en gång dagligen till patienter vars blodtryck inte 

kontrolleras adekvat av telmisartan 40 mg

Läkemedelsverket2015-05-22

Lesamor 80 mg/12,5 mg kan ges en gång dagligen till patienter vars blodtryck inte 

kontrolleras adekvat av telmisartan 80 mg

80 mg/25 mg:

Lesamor 80 mg/25 mg kangesengång dagligen tillpatienter varsblodtryckintekontrolleras

adekvatavLesamor 80 mg/12,5 mg ellertillpatientersomtidigarevaritstabilapåtelmisartanoch

hydroklortiazid givnavar för sig.

Speciella populationer

Patienter med nedsatt njurfunktion

Regelbunden kontroll av njurfunktionen rekommenderas (se avsnitt 4.4).

Samtidig användning av telmisartan och aliskiren är kontraindicerad för patienter med 

nedsatt njurfunktion (GFR < 60 ml/min/1,73 m 2 ) (se avsnitt 4.3).

Patienter med nedsatt leverfunktion

Hos patienter med milt till måttligt nedsatt leverfunktion bör dosen ej överstiga Lesamor 40 

mg/12,5 mg en gång dagligen. Lesamor är inte indicerat till patienter med svår nedsättning 

av leverfunktionen. Tiazider ska användas med försiktighet till patienter med nedsatt 

leverfunktion (se avsnitt 4.4).

Äldre

Ingen justering av dosen är nödvändig.

Pediatrisk population

Säkerhet och effekt för Lesamor för barn och ungdomar under 18 år har inte fastställts. 

Inga data finns tillgängliga.

Administreringssätt 

Lesamor tabletter är avsedda för oral administrering en gång dagligen och bör tas med 

vätska, med eller utan föda.

4.3Kontraindikationer

­Överkänslighet mot den aktiva substansen eller mot något hjälpämne som anges i 

avsnitt 6.1.

­Överkänslighet mot andra sulfonamid­derivat (eftersom hydroklortiazid är ett 

sulfonamid­derivat).

­Andra och tredje trimestern av graviditet (se avsnitt 4.4 och 4.6).

­Gallstas och gallvägsobstruktion.

­Svår nedsättning av leverfunktionen.

­Svår nedsättning av njurfunktionen (kreatininclearance < 30 ml/min).

­Refraktär hypokalemi, hyperkalcemi.

Samtidig användning av Lesamor och produkter som innehåller aliskiren är 

kontraindicerad hos patienter med diabetes mellitus eller nedsatt njurfunktion (GFR < 60 

ml/min/1,73 m 2 ) (se avsnitt 4.5 och 5.1).

4.4Varningar och försiktighet

Graviditet

Behandling med angiotensin II­antagonister bör inte påbörjas under graviditet. Om inte 

fortsatt behandling med angiotensin II­antagonister anses nödvändig, bör patienter som 

Läkemedelsverket2015-05-22

planerar graviditet, erhålla alternativ behandling där säkerhetsprofilen är väl dokumenterad 

för användning under graviditet. Vid konstaterad graviditet bör behandling med angiotensin 

II­antagonister avbrytas direkt och, om lämpligt, bör en alternativ behandling påbörjas (se 

avsnitt 4.3 och 4.6).

Läkemedelsverket2015-05-22

Nedsatt leverfunktion

Lesamor bör inte ges till patienter med gallstas, gallvägsobstruktion eller svår 

leverinsufficiens (se avsnitt 4.3), eftersom telmisartan huvudsakligen elimineras via gallan. 

Dessa patienter kan förväntas ha reducerat hepatiskt clearance för telmisartan.

Dessutom bör Lesamor användas med försiktighet till patienter med nedsatt leverfunktion 

eller progressiv leversjukdom, eftersom mindre avvikelser i vätske­ och elektrolytbalansen 

kan utlösa leverkoma. Det finns ingen klinisk erfarenhet av Lesamor hos patienter med 

nedsatt leverfunktion.

Renovaskulär hypertension

Det finns en ökad risk för svår hypotension och njurinsufficiens när patienter med bilateral 

njurartärstenos eller unilateral njurartärstenos med en kvarvarande njure behandlas med 

läkemedel som hämmar renin­angiotensin­aldosteron­systemet.

Nedsatt njurfunktion och njurtransplantation

Lesamor ska inte användas till patienter med svår nedsättning av njurfunktionen 

(kreatininclearance < 30 ml/min) (se avsnitt 4.3). Det finns ingen erfarenhet av behandling 

med telmisartan/hydroklortiazid hos patienter som nyligen genomgått en 

njurtransplantation. Erfarenhet av behandling med telmisartan/hydroklortiazid hos patienter 

med mild till måttlig nedsättning av njurfunktionen är begränsad, därför rekommenderas 

regelbundna kontroller av kaliumnivån, kreatininhalten och serumurat. Ureastegring kan 

förekomma vid behandling med tiazid­diuretika till patienter med nedsatt njurfunktion.

Intravaskulär hypovolemi

Symtomgivande hypotension, särskilt efter den första dosen, kan förekomma hos patienter 

med hyponatremi och/eller hypovolemi pga. höga doser diuretika, saltreducerad kost, 

diarré eller kräkningar. Symtomen måste åtgärdas innan behandling med Lesamor inleds.

Dubbel blockad av renin­angiotensin­aldosteronsystemet (RAAS)

Det har visats att samtidig användning av ACE­hämmare, angiotensin II­

receptorblockerare eller aliskiren ökar risken för hypotoni, hyperkalemi och nedsatt 

njurfunktion (inklusive akut njursvikt). Dubbel blockad av RAAS via kombinerad 

användning av ACE­hämmare, angiotensin II­receptorblockerare eller aliskiren 

rekommenderas därför inte (se avsnitt 4.5 och 5.1). 

Om det anses vara absolut nödvändigt med dubbel blockad får detta endast utföras under 

övervakning av en specialist, och patienten ska stå under regelbunden, noggrann 

övervakning av njurfunktion, elektrolyter och blodtryck. 

ACE­hämmare och angiotensin II­receptorblockerare bör inte användas samtidigt hos 

patienter med diabetesnefropati.

Andra tillstånd som stimulerar renin­angiotensin­systemet

Hos patienter vars kärltonus och njurfunktion huvudsakligen styrs av aktiviteten i renin­

angiotensinaldosteron­systemet (t ex patienter med svår hjärtsvikt eller bakomliggande 

njursjukdom, inklusive njurartärstenos), har behandling med läkemedel som påverkar detta 

system förknippats med akut hypotension, ureastegring, oliguri och i sällsynta fall akut 

njurinsufficiens (se avsnitt 4.8).

Primär aldosteronism

Patienter med primär aldosteronism svarar i allmänhet inte på antihypertensiva läkemedel 

som verkar genom hämning av renin­angiotensin­systemet. Behandling med Lesamor 

rekommenderas därför inte.

Stenos i aorta­ och mitralisklaffen, obstruktiv hypertrofisk kardiomyopati

Läkemedelsverket2015-05-22

Liksom med andra vasodilaterande läkemedel bör försiktighet iakttagas vid behandling av 

patienter med stenos i aorta­ eller mitralisklaffen, eller obstruktiv hypertrofisk 

kardiomyopati.

Läkemedelsverket2015-05-22

Metabola och endokrina effekter

Tiazidterapi kan försämra glukostoleransen, medan hypoglykemi kan inträffa hos 

diabetespatienter som behandlas med insulin eller antidiabetika och telmisartan. 

Blodglukosövervakning bör därför övervägas för dessa patienter. Dosjustering av insulin 

eller antidiabetika kan krävas vid behov Latent diabetes mellitus kan bli manifest under 

tiazidbehandling.

Ökade kolesterol­ och triglyceridnivåer har noterats i samband med behandling med tiazid­

diuretika, men inga eller obetydliga effekter har rapporterats vid dosen 12,5 mg, som 

Lesamor innehåller. Hyperurikemi kan förekomma eller gikt kan utlösas hos vissa patienter 

under tiazidbehandling.

Elektrolytrubbningar

Liksom för alla patienter som behandlas med diuretika, bör regelbundna mätningar av 

serumelektrolyter göras med lämpliga intervall.

Tiazider, inklusive hydroklortiazid, kan orsaka rubbningar i vätske­ eller elektrolytbalansen 

(inklusive hypokalemi, hyponatremi och hypokloremisk alkalos). Varningssignaler vid 

rubbningar i vätske­ eller elektrolytbalansen är muntorrhet, törst, asteni, letargi, trötthet, 

rastlöshet, muskelsmärta eller kramper, muskeltrötthet, hypotension, oliguri, takykardi och 

gastrointestinala symtom som illamående och kräkningar (se avsnitt 4.8 ).

Hypokalemi

Även om hypokalemi kan utvecklas vid användning av tiazid­diuretika, kan samtidig 

behandling med telmisartan minska den diuretika­inducerade hypokalemin. Risken för 

hypokalemi är störst hos patienter med levercirrhos, patienter med stor diures, patienter 

med otillräcklig oral elektrolyttillförsel och hos patienter med samtidig behandling med 

kortikosteroider eller adrenokortikotropt hormon (ACTH) (se avsnitt 4.5).

Hyperkalemi

Däremot kan den antagonism som telmisartan­komponenten i Lesamor utövar på 

angiotensin II (AT

) receptorer, leda till hyperkalemi. Även om kliniskt signifikant 

hyperkalemi inte har dokumenterats med telmisartan/hydroklortiazid, ingår njurinsufficiens 

och/eller hjärtsvikt och diabetes mellitus bland riskfaktorerna för hyperkalemi. 

Kaliumsparande diuretika, kaliumtillskott eller saltersättningar som innehåller kalium ska 

användas med försiktighet tillsammans med Lesamor (se avsnitt 4.5).

Hyponatremi och hypokloremisk alkalos

Det finns inga tecken på att Lesamor minskar eller förebygger diuretika­inducerad 

hyponatremi. Brist på klorid är vanligen mild och kräver normalt ingen behandling.

Hyperkalcemi

Tiazider kan leda till minskad utsöndring av kalcium i urinen och medföra en övergående 

och lätt höjning av serumkalcium i frånvaro av kända tillstånd som påverkar 

kalciummetabolismen. Uttalad hyperkalcemi kan vara ett tecken på dold 

hyperparathyroidism. Tiazider ska utsättas innan undersökningar av 

parathyroideafunktionen genomförs.

Hypomagnesemi

Tiazider har visats leda till ökad urinutsöndring av magnesium, vilket kan leda till 

hypomagnesemi (se avsnitt 4.5).

Etniska skillnader

Liksom alla andra angiotensin II receptor­antagonister, ger telmisartan uppenbart mindre 

effektiv blodtryckssänkning hos svarta patienter än hos icke svarta, troligen pga. en högre 

prevalens av låg reninstatus hos den svarta hypertonipopulationen.

Läkemedelsverket2015-05-22

Övrigt

Liksom med alla antihypertensiva läkemedel, skulle en hjärtinfarkt eller stroke kunna 

utlösas av en kraftig blodtryckssänkning hos patienter med ischemisk hjärtsjukdom eller 

ischemisk kardiovaskulär sjukdom.

Allmänt

Överkänslighetsreaktioner mot hydroklortiazid kan förekomma hos patienter med eller utan 

anamnes på allergi eller bronkialastma, men är mer trolig hos patienter med sådan 

bakgrund. Exacerbationer av systemisk lupus erythematosus har rapporterats vid 

användning av tiazid­diuretika, inklusive hydroklortiazid.

Fall av fotosensitivitet har rapporterats med tiazid­diuretika (se avsnitt 4.8). Om en 

fotosensitivitetsreaktion inträffar under behandlingen, rekommenderas att man avbryter 

behandlingen. Om återinsättning anses nödvändig, är rekommendationen att skydda 

exponerade ytor från solen eller artificiellt UVA.

Akut myopi och glaukom med sluten kammarvinkel

Hydroklortiazid, en sulfonamid, kan orsaka en idiosynkratisk reaktion, som resulterar i en 

akut övergående myopi och akut glaukom med sluten kammarvinkel. Symtomen inkluderar 

akut tillslag av minskad synskärpa eller ögonsmärta och uppträder normalt inom timmar till 

veckor efter insättning av läkemedlet. Obehandlat akut glaukom med sluten kammarvinkel 

kan leda till permanent synnedsättning. Primär behandling är utsättning av hydroklortiazid 

så snart som möjligt. Omedelbara medicinska eller kirurgiska behandlingar kan behöva 

övervägas om det intraokulära trycket förblir okontrollerat. Riskfaktorer för att utveckla akut 

glaukom med sluten kammarvinkel kan inkludera tidigare allergi mot sulfonamid eller 

penicillin.

4.5Interaktioner med andra läkemedel och övriga interaktioner

Dubbel blockad av renin­angiotensin­aldosteron­systemet (RAAS)

Data från kliniska prövningar har visat att förekomsten av biverkningar som hypotoni, 

hyperkalemi och nedsatt njurfunktion (inklusive akut njursvikt) är högre vid dubbel blockad 

av renin­angiotensin­ aldosteron­systemet (RAAS) genom kombinerad användning av 

ACE­hämmare, angiotensin II­receptorblockerare eller aliskiren jämfört med användning av 

ett enda läkemedel som påverkar RAAS (se avsnitt 4.3, 4.4 och 5.1).

Litium

Reversibel ökning av serumkoncentrationen och toxicitet av litium har rapporterats vid 

samtidig användning av litium och ACE­hämmare. Sällsynta fall har även rapporterats med 

angiotensin II antagonister

(inklusive telmisartan/hydroklortiazid). Samtidig behandling med litium och Lesamor 

rekommenderas inte (se avsnitt 4.4). Om kombinationen är nödvändig, rekommenderas 

noggrann uppföljning av litium i serum.

Läkemedel som kan medföra kaliumförlust och hypokalemi (t ex andra kaliuretiska 

diuretika, laxermedel, kortikosteroider, ACTH, amfotericin, carbenoxolon, penicillin G­

natrium, salicylsyra och dess derivat).

Om dessa substanser förskrivs samtidigt som hydroklortiazid­telmisartan­kombinationen, 

bör plasmanivåerna av kalium följas. Dessa läkemedel kan potentiera effekten av 

hydroklortiazid på serumkalium (se avsnitt 4.4).

Läkemedel som kan leda till ökade kaliumnivåer och hyperkalemi (ACE­hämmare, 

kaliumsparande diuretika, kaliumtillskott, saltersättning som innehåller kalium, ciklosporin 

eller andra läkemedel som heparin­natrium).

Läkemedelsverket2015-05-22

Om dessa läkemedel förskrivs samtidigt som hydroklortiazid­telmisartan­kombinationen, 

bör plasmanivåerna av kalium följas. Baserat på erfarenhet av användning av läkemedel 

som hämmar renin­angiotensinsystemet, kan samtidig användning av dessa läkemedel 

leda till ökat serumkalium och kan därför inte rekommenderas (se avsnitt 4.4).

Läkemedel som påverkas av störningar i serumkalium

Regelbunden kontroll av serumkalium och EKG rekommenderas när Lesamor ges 

tillsammans med läkemedel som påverkas av förändringar i serumkalium­nivån (t ex 

digitalisglykosider, antiarytmika) och följande läkemedel som kan leda till Torsade de 

pointes (vilket inkluderar vissa antiarytmika), hypokalemi är en predisponerande faktor för 

Torsade de pointes.

­klass Ia antiarytmika (t ex kinidin, hydrokinidin, disopyramid)

­klass III antiarytmika (t ex amiodaron, sotalol, dofetilid, ibutilid)

­vissa antipsykotiska läkemedel (t ex tioridazin, klorpromazin, levopromazin, 

trifluoperazin, cyamemazin, sulpirid, sultoprid, amisulprid, tiaprid, pimozid, 

haloperidol, droperidol)

­övriga: (t ex bepridil, cisaprid, difemanil, erytromycin IV, halofantrin, mizolastin, 

pentamidin, sparfloxacin, terfenadin, vincamin IV.)

Digitalisglykosider

Tiazid­inducerad hypokalemi eller hypomagnesemi kan leda till digitalis­inducerad arytmi 

(se avsnitt 4.4).

Digoxin

När telmisartan gavs samtidigt med digoxin, observerades en ökning av maximal 

plasmakoncentration (median 49 %) samt för dalvärde (median 20 %) av digoxin. Vid 

insättning, justering eller utsättning av telmisartan ska digoxinnivåerna monitoreras så att 

de bibehålls inom det terapeutiska området.

Andra antihypertensiva läkemedel

Telmisartan kan öka den antihypertensiva effekten av andra antihypertensiva läkemedel.

Diabetesläkemedel (orala antidiabetika och insulin)

Dosjustering av diabetesläkemedlet kan behövas (se avsnitt 4.4).

Metformin

Metformin bör användas med försiktighet: det finns risk för att lakto­acidos utlöses genom 

en eventuell funktionell njurinsufficiens knuten till hydroklortiazid.

Kolestyramin och kolestipol

Absorptionen av hydroklortiazid försämras i närvaro av anjonbytar­resiner.

Icke­steroida antiinflammatoriska läkemedel

NSAID (dvs. acetylsalicylsyra i antiinflammatorisk dos, COX­2­hämmare och icke selektiva 

NSAID) kan minska den diuretiska, natriuretiska och antihypertensiva effekten av tiazid­

diuretika och den antihypertensiva effekten av angiotensin­II­ receptor­antagonister.

Hos vissa patienter med nedsatt njurfunktion (t ex dehydrerade patienter eller äldre 

patienter med nedsatt njurfunktion) kan samtidig användning av angiotensin­II­receptor­

antagonister och läkemedel som hämmar cyklooxygenas leda till ytterligare försämring av 

njurfunktionen, eventuellt inklusive akut njursvikt, som vanligen är reversibel. Av det skälet 

ska kombinationen användas med försiktighet, särskilt hos äldre. Patienter ska vara 

adekvat hydrerade och man bör överväga att monitorera njurfunktionen efter att 

behandlingen har initierats och med jämna mellanrum därefter.

I en studie gav kombinationen telmisartan och ramipril en 2,5­faldig ökning av AUC

0­24  och 

 för ramipril och ramiprilat. Den kliniska relevansen av denna observation är okänd.

Läkemedelsverket2015-05-22

Blodtryckshöjande aminer (t ex noradrenalin)

Effekten av dessa aminer kan minska.

Icke depolariserande skelettmuskelrelaxantia (t ex tubokurarin)

Effekten av icke depolariserande skelettmuskelrelaxantia kan potentieras av 

hydroklortiazid.

Läkemedel för behandling av gikt (t ex probenecid, sulfinpyrazon och allopurinol)

Dosjustering av den urinsyradrivande behandlingen kan vara nödvändig eftersom 

hydroklortiazid kan höja nivån av serumurat. Ökad dosering av probenecid eller 

sulfinpyrazon kan vara nödvändig.

Samtidig tillförsel av tiazider kan leda till ökad incidens av överkänslighetsreaktioner mot 

allopurinol.

Kalciumsalter

Tiazid­diuretika kan öka serumkalcium pga. minskad utsöndring. Om kalciumtillskott måste 

förskrivas, bör serumkalciumnivåerna följas och utgöra underlag för justering av 

kalciumdosen.

Läkemedelsverket2015-05-22

Betablockerare och diazoxid

Den hyperglykemiska effekten av betablockerare och diazoxid kan förstärkas av tiazider.

Antikolinergika (t ex atropin, biperiden) kan leda till ökad biotillgänglighet för tiazid­diuretika 

genom minskad gastrointestinal motilitet och ventrikeltömningshastighet.

Amantadin

Tiazider kan leda till ökad risk för biverkningar av amantadin.

Cytotoxiska läkemedel (t ex cyklofosfamid, metotrexat)

Tiazider kan leda till minskad renal utsöndring av cytotoxiska läkemedel och potentiera den 

myelosuppressiva effekten.

Baserat på de farmakologiska egenskaperna kan följande läkemedel väntas potentiera 

den hypotensiva effekten av antihypertensiva läkemedel inklusive telmisartan: baklofen, 

amifostin.

Dessutom kan ortostatisk hypotension förvärras av alkohol, barbiturater, narkotika och 

antidepressiva.

4.6Fertilitet, graviditet och amning

Graviditet

Angiotensin II­antagonister bör inte användas under graviditetens första trimester (se 

avsnitt 4.4). Angiotensin II­antagonister är kontraindicerade under graviditetens andra och 

tredje trimester (se avsnitt 4.3 och 4.4).

Det finns inte tillräckliga data beträffande användning av Lesamor till gravida kvinnor. 

Studier på djur har visat reproduktionstoxicitet (se avsnitt 5.3).

Epidemiologiska data rörande risk för fosterskada efter användning av ACE­hämmare 

under graviditetens första trimester är inte entydiga: en något ökad risk kan inte uteslutas. 

Kontrollerade epidemiologiska data saknas för angiotensin II­antagonister men likartade 

risker kan föreligga för denna läkemedelsgrupp. Om inte fortsatt behandling med 

angiotensin II­antagonister anses nödvändig, bör patienter som planerar graviditet, erhålla 

alternativ behandling där säkerhetsprofilen är väl dokumenterad för användning under 

graviditet. Vid konstaterad graviditet bör behandling med angiotensin II antagonister 

avbrytas direkt och, om lämpligt, bör en alternativ behandling påbörjas.

Det är känt att behandling med angiotensin II­antagonister under andra och tredje 

trimestern kan inducera human fostertoxicitet (nedsatt njurfunktion, oligohydramnios, 

hämning av skallförbening) och neonatal toxicitet (njursvikt, hypotension, hyperkalemi). (Se 

avsnitt 5.3). Om exponering för angiotensin II­antagonister förekommit under graviditetens 

andra trimester rekommenderas ultraljudskontroll av njurfunktion och skalle.

Spädbarn vars mödrar har använt angiotensin II­antagonister bör observeras noggrant 

med avseende på hypotension (se avsnitt 4.3 och 4.4).

Det finns begränsad erfarenhet av användning av hydroklortiazid under graviditet, särskilt 

under den första trimestern. Djurstudier är otillräckliga. Hydroklortiazid passerar 

placentabarriären. Baserat på den farmakologiska verkningsmekanismen för 

hydroklortiazid kan användning under andra och tredje trimestern störa foster/placenta­

perfusionen och orsaka fetala och neonatala effekter som ikterus, störningar i 

elektrolytbalansen och trombocytopeni. Hydroklortiazid bör inte användas vid 

graviditetsödem, graviditetshypertoni eller vid havandeskapsförgiftning på grund av risken 

Läkemedelsverket2015-05-22

för minskad plasmavolym och försämrad placentagenomblödning utan att 

sjukdomsförloppet påverkas positivt.

Hydroklortiazid bör inte användas vid essentiell hypertoni hos gravida kvinnor, förutom i 

sällsynta situationer där ingen annan behandling kan användas.

Läkemedelsverket2015-05-22

Amning

Eftersom information saknas angående användning av Lesamor under amning, 

rekommenderas inte Lesamor. I stället är alternativa behandlingar med bättre 

dokumenterad säkerhetsprofil att föredra under amning, speciellt vid amning av nyfödda 

eller prematura barn.

Hydroklortiazid utsöndras i human modersmjölk i små mängder. Höga doser av tiazider 

som orsakar kraftig diures kan hämma mjölkproduktionen. Användning av Lesamor under 

amning rekommenderas inte. Om Lesamor används under amning, ska lägsta möjliga dos 

eftersträvas.

Fertilitet

I prekliniska studier har inga effekter av telmisartan eller hydroklortiazid på manlig eller 

kvinnlig fertilitet observerats.

4.7Effekter på förmågan att framföra fordon och använda maskiner

Vid framförande av fordon och användning av maskiner ska man dock beakta att 

antihypertensiva läkemedel såsom Lesamor i enstaka fall kan orsaka yrsel och dåsighet.

4.8Biverkningar

Sammanfattning av säkerhetsprofilen

Den vanligastrapporteradebiverkningenär yrsel.Allvarligtangioödemkan förekommaisällsynta

fall(≥1/10 000 till<1/1000).

40 mg/12,5 mg och 80 mg/12,5 mg:

Den totala incidensen av rapporterade biverkningar med telmisartan/hydroklortiazid har 

visat sig vara likartad den som observerats med enbart telmisartan i randomiserade 

kliniska studier hos 1471 patienter som randomiserade till behandling med telmisartan plus 

hydroklortiazid (835) eller enbart telmisartan (636). Biverkningar uppvisade ingen relation 

till dosen eller korrelation till kön, ålder eller ras.

80 mg/25 mg:

Den totalaincidensenav rapporteradebiverkningarmed telmisartan/hydroklortiazid 80 mg/25 mg

ärjämförbarmed telmisartan/hydroklortiazid80 mg/12,5 mg.Biverkningaruppvisadeingen

relationtilldosen eller korrelationtillkön, åldereller ras.

Sammanfattning av biverkningar i tabellform

Biverkningar som har rapporterats i kliniska studier och som förekom oftare (p ≤0,05) med 

telmisartan plus hydroklortiazid än med placebo visas nedan fördelade på system­

organklass. Biverkningar som är kända vid behandling med en av komponenterna, men 

inte har setts i de kliniska studierna, kan förekomma under behandling med Lesamor.

Biverkningarna har sorterats enligt frekvens i följande kategorier:

mycket vanliga (≥ 1/10); vanliga (≥ 1/100, < 1/10); mindre vanlig (≥ 1/1 000, < 1/100); 

sällsynta (≥ 1/10 000, <1/1 000), mycket sällsynta <1/10 000), ingen känd frekvens (kan 

inte beräknas från tillgängliga data).

Biverkningarna presenteras inom varje frekvensområde efter fallande allvarlighetsgrad.

Infektioner och infestationer

Sällsynta: Bronkit, faryngit, sinuit

Läkemedelsverket2015-05-22

Immunsystemet

Sällsynta: Exacerbation eller aktivering av systemisk lupus erythematosus 1

Läkemedelsverket2015-05-22

Metabolism och nutrition

Mindre vanliga: Hypokalemi

Sällsynta: Hyperurikemi, hyponatremi

Psykiska störningar

Mindre vanliga: Ångest

Sällsynta: Depression

Centrala och perifera nervsystemet

Vanliga: Yrsel

Mindre vanliga: Synkopé, parestesi

Sällsynta: Insomnia, sömnstörningar

Ögon

Sällsynta: Synstörning, dimsyn

Öron och balansorgan

Mindre vanliga: Vertigo

Hjärtat

Mindre vanliga: Takykardi, arytmi

Blodkärl

Mindre vanliga: Hypotension, ortostatisk hypotension

Andningsvägar, bröstkorg och mediastinum

Mindre vanliga: Dyspné

Sällsynta: Respiratorisk påverkan (inklusive pneumonit och lungödem)

Magtarmkanalen

Mindre vanliga: Diarré, muntorrhet, flatulens

Sällsynta: Buksmärta, förstoppning, dyspepsi, kräkning, gastrit

Lever och gallvägar

Sällsynta: Avvikande leverfunktion/leverrubbning 2

Hud och subkutan vävnad

Sällsynta: Angioödem (även med dödlig utgång), erythem, pruritus, hudutslag, 

hyperhidros, urtikaria

Muskuloskeletala systemet och bindväv

Mindre vanliga: Ryggsmärta, muskelspasmer, myalgi

Sällsynta: Artralgi, muskelkramper, smärta i armar och ben

Reproduktionsorgan och bröstkörtel

Mindre vanliga Erektil dysfunktion

Allmänna symtom och/eller symtom vid administreringsstället

Mindre vanliga: Bröstsmärta

Sällsynta: Influensaliknande sjukdom, smärta

Undersökningar

Mindre vanliga: Ökad halt urinsyra i blodet

Sällsynta: Ökad halt kreatinin och kreatinfosfokinas i blodet, ökad halt leverenzymer i 

blodet.

Läkemedelsverket2015-05-22

: Baserat på erfarenhet efter marknadsintroduktion

: För ytterligare beskrivning se avsnitt  Beskrivning av vissa biverkningar

Ytterligare information om de enskilda komponenterna

De biverkningar som tidigare rapporterats med en av de enskilda komponenterna kan vara 

potentiella biverkningar för Lesamor även om detta inte observerats i kliniska studier med 

detta preparat.

Telmisartan

Biverkningar förekom med likartad frekvens hos patienter behandlade med placebo och 

telmisartan.

Den totala incidensen av biverkningar som rapporterades med telmisartan (41,4 %) var 

vanligen jämförbar med placebo (43,9 %) i placebokontrollerade studier. Följande 

biverkningar har rapporterats från alla kliniska studier hos patienter som behandlas med 

telmisartan för hypertension eller patienter 50 år eller äldre med hög risk för 

kardiovaskulära händelser.

Infektioner och infestationer

Mindre vanliga: Övre luftvägsinfektion, urinvägsinfektion inklusive cystit

Sällsynta: Sepsis, även med fatal utgång 3

Blodet och lymfsystemet

Mindre vanliga: Anemi

Sällsynta: Eosinofili, trombocytopeni

Immunsystemet

Sällsynta: Överkänslighet, anafylaktiska reaktioner

Metabolism och nutrition

Mindre vanliga: Hyperkalemi

Sällsynta: Hypoglykemi (hos diabetespatienter)

Hjärtat

Mindre vanliga: Bradykykardi

Centrala och perifera nervsystemet

Sällsynta: Somnolens

Andningsvägar, bröstkorg och mediastinum

Sällsynta: Hosta

Mycket sällsynta: Interstitiell lungsjukdom 3

Magtarmkanalen

Sällsynta: Gastrointestinala besvär

Hud och subkutan vävnad

Sällsynta: Eksem, läkemedelsutslag, toxisk huderuption

Muskuloskeletala systemet och bindväv

Sällsynta: Artros, sensmärta

Njurar och urinvägar

Mindre vanliga Nedsatt njurfunktion (inklusive akut njursvikt)

Allmänna symtom och/eller symtom vid administreringsstället

Läkemedelsverket2015-05-22

Mindre vanliga: Asteni

Undersökningar

Sällsynta: Minskat hemoglobin

3: För ytterligare beskrivning, se avsnitt  Beskrivning av vissa biverkningar 

Hydroklortiazid

Hydroklortiazid kan orsaka eller förvärra den hypovolemi som kan leda till 

elektrolytstörningar (se avsnitt 4.4).

Biverkningar med okänd frekvens har rapporterats vid behandling med enbart 

hydroklortiazid inkluderar:

Infektioner och infestationer

Ingen känd frekvens: Sialadenit

Blodet och lymfsystemet

Ingen känd frekvens: Aplastisk anemi, hemolytisk anemi, benmärgsdepression, 

leukopeni, neutropeni, agranulocytos, trombocytopeni

Immunsystemet

Ingen känd frekvens: Anafylaktiska reaktioner, överkänslighet

Endokrina systemet

Ingen känd frekvens: Diabetes mellitus utan fullgod kontroll

Metabolism och nutrition

Ingen känd frekvens: Anorexi, aptitförlust, elektrolytrubbningar, hyperkolesterolemi, 

hyperglykemi, hypovolemi

Psykiska störningar

Ingen känd frekvens: Rastlöshet

Centrala och perifera nervsystemet

Ingen känd frekvens: Yrsel

Ögon

Ingen känd frekvens: Gulseende, akut myopi, akut glaukom med sluten 

kammarvinkel

Blodkärl

Ingen känd frekvens: Nekrotiserande vaskulit

Muskuloskeletala systemet och bindväv

Ingen känd frekvens: Asteni

Magtarmkanalen

Ingen känd frekvens: Pankreatit, magbesvär

Lever och gallvägar

Ingen känd frekvens: Hepatocellulär gulsot, kolestatisk gulsot

Hud och subkutan vävnad

Ingen känd frekvens: Lupusliknande syndrom, fotosensitivitetsreaktioner, hudvaskulit, 

toxisk epidermal nekrolys

Läkemedelsverket2015-05-22

Muskuloskeletala systemet och bindväv

Ingen känd frekvens: Kraftlöshet

Njurar och urinvägar

Ingen känd frekvens: Interstitiell nefrit, nedsatt njurfunktion, glykosuri

Allmänna symtom och/eller symtom vid administreringsstället

Ingen känd frekvens: Pyrexi

Undersökningar

Ingen känd frekvens: Ökning av triglycerider

Beskrivning av vissa biverkningar

Avvikande leverfunktion/leverrubbning

Flest fall av avvikande leverfunktion/leverrubbning efter marknadsintroduktion av 

telmisartan har inträffat hos japanska patienter. Japanska patienter har högre sannolikhet 

att uppleva dessa biverkningar.

Sepsis

I ProFESS studien observerades en förhöjd incidens av sepsis med telmisartan jämfört 

med placebo. Dessa biverkningar kan vara en tillfällighet eller relaterade till en mekanism 

som för närvarande inte är känd (se avsnitt 5.1).

Interstitiell lungsjukdom

Fall av interstitiell lungsjukdom i tidsmässigt samband med intag av telmisartan, har 

rapporterats efter marknadssintroduktionen. Ett orsakssamband har dock inte fastställts.

Rapportering av misstänkta biverkningar

Det är viktigt att rapportera misstänkta biverkningar efter att läkemedlet godkänts. Det gör 

det möjligt att kontinuerligt övervaka läkemedlets nytta­riskförhållande. Hälso­ och 

sjukvårdspersonal uppmanas att rapportera varje misstänkt biverkning till (se detaljer 

nedan):

Läkemedelsverket

Box 26

751 03 Uppsala

Webbplats:  www.lakemedelsverket.se

4.9Överdosering

Det finns begränsade data beträffande överdosering av telmisartan hos människa. Graden 

av hur mycket hydroklortiazid som försvinner med hemodialys har inte kunnat fastställas.

Symtom

De mest framträdande tecknen på överdosering av telmisartan var hypotoni och takykardi. 

Bradykardi, yrsel, kräkningar, ökat serumkreatinin och akut njursvikt har också 

rapporterats. Överdosering med hydroklortiazid förknippas med elektrolytförlust 

(hypokalemi, hypokloremi) och hypovolemi som ett resultat av kraftig diures. De vanligaste 

tecknen och symtomen på överdosering är illamående och somnolens. Hypokalemi kan 

resultera i muskelspasmer och/eller accentuerad arytmi associerad med samtidig 

behandling med digitalisglykosider och vissa antiarytmiska läkemedel.

Behandling

Läkemedelsverket2015-05-22

Telmisartan elimineras inte vid hemodialys. Patienten bör övervakas noga och 

behandlingen ska vara symtomatisk och understödjande. Behandlingen beror på tiden 

efter intag och symtomens allvarlighetsgrad. Föreslagna åtgärder är igångsättning av 

kräkningar och/eller magpumpning. Aktivt kol kan vara användbart vid behandling av 

överdosering. Serumelektrolyter och kreatinin ska följas ofta. Om hypotension uppträder, 

ska patienten placeras i ryggläge och snabbt ges salt och vätskeersättning.

Läkemedelsverket2015-05-22

5. FARMAKOLOGISKA EGENSKAPER

5.1 Farmakodynamiska egenskaper

Farmakoterapeutisk grupp: Angiotensin II­antagonister, kombinationer, ATC­kod: C09D 

A07.

Lesamor är en kombination av en angiotensin II­antagonist, telmisartan, och ett tiazid­

diuretikum, hydroklortiazid. Kombinationen av dessa innehållsämnen har en additiv 

antihypertensiv effekt, dvs. reducerar blodtrycket i högre utsträckning än vardera 

komponenten enbart. Lesamor en gång dagligen leder till effektiv sänkning av blodtrycket 

inom det terapeutiska dosintervallet.

Telmisartan är, oralt given, en effektiv och specifik angiotensin II­receptor­subtyp (AT

antagonist.

Telmisartan tränger med mycket hög affinitet bort angiotensin II från bindningsställena på 

­receptorn, som svarar för de kända effekterna av angiotensin II. Telmisartan uppvisar 

ingen effekt som partiell agonist vid AT

­receptorn. Telmisartan binds selektivt till AT

receptorn. Bindningen har lång duration. Telmisartan uppvisar ingen affinitet till andra 

receptorer, såsom AT

 och andra sämre karaktäriserade AT­receptorer. Den funktionella 

rollen för dessa receptorer är inte känd, inte heller effekten av eventuell överstimulering av 

angiotensin II, vars nivåer ökar med telmisartan. Telmisartan leder till minskade 

aldosteron­nivåer i plasma. Telmisartan hämmar inte humant plasmarenin och har inte 

någon jonkanalblockerande förmåga. Telmisartan hämmar inte det 

angiotensinomvandlande enzymet (kininas II), vilket är det enzym som också bryter ner 

bradykinin. Man förväntar sig därför inte någon potentiering av bradykininmedierade 

biverkningar.

En dos på 80 mg telmisartan till friska försökspersoner hämmar nästan fullständigt den 

ökning av blodtrycket som utlöses av angiotensin II. Hämningen varar mer än 24 timmar 

och är fortfarande mätbar upp till 48 timmar.

Den antihypertensiva effekten inträder gradvis inom 3 timmar efter den första dosen 

telmisartan. Den maximala sänkningen av blodtrycket uppnås vanligtvis 4 ­ 8 veckor efter 

behandlingsstart och den bibehålles under långtidsbehandling. Den antihypertensiva 

effekten kvarstår oförändrad under 24 timmar efter dosering. Detta har visats med 

ambulatoriska blodtrycksmätningar under de sista 4 timmarna före nästa dos. Detta 

bekräftas även av att kvoten mellan lägsta och högsta blodtrycksvärde ligger över 80 % 

efter intag av 40­80 mg telmisartan i placebokontrollerade kliniska studier.

Hos patienter med hypertoni sänker telmisartan systoliskt och diastoliskt blodtryck utan att 

påverka hjärtfrekvensen. Den antihypertensiva effekten av telmisartan är jämförbar med 

effekten av andra typer av antihypertensiva läkemedel (vilket visats i kliniska prövningar 

där telmisartan jämförts med amlodipin, atenolol, enalapril, hydroklortiazid och lisinopril).

80 mg/25 mg:

I endubbelblindkontrollerad klinisk studie(n=687 patienterutvärderademedavseendepåeffekt)

mednon-responderstillkombinationen80 mg/12,5mgsågsenökning idenblodtryckssänkande

effekten med2,7/7,6 mmHg (systolisktblodtryck/diastolisktblodtryck) vidbehandlingmed

kombinationen 80 mg/25mgjämförtmedfortsattbehandling medkombinationen 80 mg/12,5 mg

(skillnad ianpassademedelvärdenfrån baslinjen). I en uppföljandestudiemedkombinationen 80

mg/12,5mgminskadeblodtrycketytterligare(resulterandeiengenerellminskningmed 11,5/9,9

mmHg (systolisktblodtryck/diastolisktblodtryck)).

I en poolad analys av två liknande 8 veckors dubbelblinda placebokontrollerade studier 

jämfört med valsartan/hydroklortiazid 160 mg/25 mg (n=2121 patienter utvärderade med 

Läkemedelsverket2015-05-22

avseende på effekt) sågs en signifikant större blodtryckssänkande effekt med 2,2/1,2 mm 

Hg (systoliskt blodtryck/diastoliskt blodtryck) med förmån för kombinationen 

telmisartan/hydroklortiazid 80 mg/25 mg (skillnad i anpassade medelvärden från 

baslinjen).

Vid abrupt utsättning av behandling med telmisartan, återgår blodtrycket gradvis till 

blodtrycksnivån före behandlingen under flera dagar, utan några tecken på hastig 

blodtrycksstegring (”rebound hypertension”).

Incidensen av torrhosta var signifikant lägre hos patienter som behandlats med telmisartan 

jämfört med de som fick ACE­hämmare vid direkta jämförelser i kliniska studier.

I studien ”Prevention Regimen For Effectively avoiding Second Strokes” (PRoFESS) 

inkluderande patienter 50 år eller äldre, som nyligen genomgått stroke, noterades en ökad 

incidens sepsis med telmisartan jämfört med placebo, 0,70 % jämfört med 0,49 % [RR 

1,43 (96 % konfidensintervall 1,00 – 2,06)]; incidensen fatal sepsis var förhöjd hos 

patienter som behandlades med telmisartan (0,33 %) jämfört med patienter på placebo 

(0,16 %) [RR 2,07 (95 % konfidensintervall 1,14 – 3,76)]. Den observerade ökningen i 

förekomst av sepsis som var relaterad till användning av telmisartan kan antingen vara en 

tillfällighet eller ha samband med en mekanism som för närvarande inte är känd.

Effekten av telmisartan på mortalitet och kardiovaskulär morbiditet är för närvarande inte 

känd.

Hydroklortiazid är ett tiazid­diuretikum. Mekanismen för den antihypertensiva effekten av 

tiaziddiuretika är inte fullt känd. Tiazider påverkar njurtubulis förmåga att reabsorbera 

elektrolyter och ökar utsöndringen av natrium och klorid i ungefär samma grad. Den 

diuretiska effekten av hydroklortiazid leder till minskad plasmavolym, ökad plasmarenin­

aktivitet, ökad aldosteronsekretion, vilket innebär ökad förlust av kalium och bikarbonat i 

urinen samt minskat serum­kalium. Samtidig användning av telmisartan tenderar att 

motverka kaliumförlusten vid diuretikabehandling, troligen genom blockad av renin­

angiotensin­aldosteron­systemet. Med hydroklortiazid påbörjas diuresen inom 2 timmar, 

med maximal effekt efter ca 4 timmar, effekten varar 6­12 timmar.

Epidemiologiska studier har visat att långtidsbehandling med hydroklortiazid leder till 

minskad kardiovaskulär mortalitet och morbiditet.

Effekten av den fasta kombinationen telmisartan/hydroklortiazid på mortalitet och 

kardiovaskulär morbiditet är för närvarande inte känd.

Tvåstorarandomiserade,kontrolleradeprövningar(ONTARGET(ONgoingTelmisartanAloneandin

combinationwithRamiprilGlobalEndpointTrial)ochVANEPHRON-D(TheVeteransAffairsNephropathy

inDiabetes))harundersöktdenkombineradeanvändningenavenACE-hämmareochenangiotensinII-

receptorblockerare.

ONTARGETvarenstudiesomgenomfördespåpatientermedenanamnesavkardiovaskuläroch

cerebrovaskulärsjukdom,ellertyp2-diabetesmellitusåtföljtavevidensförslutorganskada.VANEPHRON-

Dvarenstudiepåpatientermedtyp2-diabetesmellitusochdiabetesnefropati.

Dessastudierharintevisatnågonsignifikantnyttapårenalaoch/ellerkardiovaskuläraresultatochmortalitet,

medanenökadriskförhyperkalemi,akutnjurskadaoch/ellerhypotoniobserveradesjämförtmed

monoterapi.Dåderasfarmakodynamiskaegenskaperliknarvarandraärdessaresultatävenrelevantaför

andraACE-hämmareochangiotensinII-receptorblockerare.

ACE-hämmareochangiotensinII-receptorblockerarebördärförinteanvändassamtidigthospatientermed

diabetesnefropati.

ALTITUDE (Aliskiren Trial in Type 2 Diabetes Using Cardiovascular and Renal Disease 

Endpoints) var en studie med syfte att testa nyttan av att lägga till aliskiren till en 

standardbehandling med en ACE­hämmare eller en angiotensin II­receptorblockerare hos 

patienter med typ 2­diabetes mellitus och kronisk njursjukdom, kardiovaskulär sjukdom 

Läkemedelsverket2015-05-22

eller både och. Studien avslutades i förtid eftersom det fanns en ökad risk för oönskat 

utfall. Både kardiovaskulär död och stroke var numerärt vanligare i aliskiren­gruppen än i 

placebo­gruppen och oönskade händelser och allvarliga oönskade händelser av intresse 

(hyperkalemi, hypotoni och njurdysfunktion) rapporterades med högre frekvens i aliskiren­

gruppen än i placebo­gruppen.

5.2Farmakokinetiska egenskaper

Samtidig tillförsel av hydroklortiazid och telmisartan förefaller inte påverka 

farmakokinetiken av endera substansen hos friska försökspersoner.

Absorption

Telmisartan: Efter oral tillförsel uppnås maximal plasmakoncentration av telmisartan inom 

0,5 ­ 1,5 timme efter dosering. Den absoluta biotillgängligheten för telmisartan 40 mg resp. 

160 mg var 42 % resp. 58 %. När telmisartan intas med föda minskar biotillgängligheten 

med en minskning av ytan under plasmakoncentration­tidkurvan (AUC 0­∞) med ca 6 % 

med 40 mg telmisartan och med ca 19 % med dosen 160 mg. Tre timmar efter dosering är 

plasmakoncentrationen likartad vare sig telmisartan intagits med eller utan föda. 

Minskningen i AUC är liten och förväntas inte leda till en minskad terapeutisk effekt. 

Farmakokinetiken av oralt tillfört telmisartan är icke­linjär i dosintervallet 20­160 mg med 

mer än proportionella ökningar av plasmakoncentration (C

 och AUC) med ökande dos. 

Telmisartan ackumuleras inte signifikant i plasma vid upprepad tillförsel.

Hydroklortiazid: Efter oral tillförsel av telmisartan/ hydroklortiazid uppnås 

maxkoncentrationen av hydroklortiazid ungefär 1,0 – 3,0 timmar efter dosering. Baserat på 

den kumulativa renala utsöndringen av hydroklortiazid var den absoluta biotillgängligheten 

ca 60 %.

Distribution

Telmisartan är höggradigt bundet till plasmaproteiner (> 99,5 %), framförallt albumin och 

alfa­1­glykoprotein. Distributionsvolymen för telmisartan vid steady state (Vdss) är ungefär 

500 liter, vilket tyder på att telmisartan också binder till vävnaderna. 

Hydroklortiazid är proteinbundet till 68 % och distributionsvolymen är 0,83 ­ 1,14 l/kg.

Metabolism

Telmisartan metaboliseras genom konjugering till farmakologiskt inaktiv acylglukuronid. 

Glukuronid av modersubstansen är den enda metabolit som har identifierats hos 

människa. Efter en engångsdos av  14 C­märkt telmisartan representerar glukuroniden 11 % 

av radioaktiviteten i plasma. Cytokrom P450 isoenzymer deltar inte i metaboliseringen av 

telmisartan.

Hydroklortiazid metaboliseras inte hos människa.

Eliminering

Telmisartan: Efter oral eller intravenös tillförsel av  14 C­märkt telmisartan elimineras 

huvuddelen av dosen (> 97 %) i faeces, via biliär utsöndring. Endast obetydliga mängder 

återfanns i urin. Total plasmaclearance av telmisartan efter oral tillförsel är> 1500 ml/ min. 

Terminal halveringstid var> 20 timmar.

Hydroklortiazid utsöndras i huvudsak som oförändrad substans i urinen. Ca 60 % av den 

orala dosen elimineras inom 48 timmar. Renalt clearance är ca 250­300 ml/min. Den 

terminala eliminationshalveringstiden för hydroklortiazid är 10­15 timmar.

Speciella patientgrupper

Äldre

Läkemedelsverket2015-05-22

Farmakokinetiken för telmisartan skiljer sig inte åt hos äldre och patienter under 65 år.

Kön

Plasmakoncentrationen av telmisartan är ungefär 2­3 gånger högre hos kvinnor än hos 

män. I kliniska studier fann man dock inte någon signifikant skillnad i blodtryckssvar eller 

incidens av ortostatisk hypotension hos kvinnor. Inga dosjusteringar är nödvändiga. Det 

finns en trend till högre plasmakoncentrationer av hydroklortiazid hos kvinnor än hos män. 

Detta anses inte ha klinisk relevans.

Nedsatt njurfunktion

Renal utsöndring bidrar inte till clearance av telmisartan. Baserat på begränsad erfarenhet 

av patienter med mild till måttlig nedsättning av njurfunktionen (kreatininclearance 30­60 

ml/min, genomsnittsvärde ca 50 ml/min) är det inte nödvändigt med dosjustering till 

patienter med nedsatt njurfunktion. Telmisartan eliminineras inte från blodet via 

hemodialys. Hos patienter med nedsatt njurfunktion är hastigheten av hydroklortiazid­

eliminationen reducerad. I en studie med patienter med genomsnittligt kreatininclearance 

på 90 ml/min ökade eliminationshalveringstiden av hydroklortiazid. Hos patienter utan 

egen njurfunktion var halveringstiden för eliminationen ca 34 timmar.

Nedsatt leverfunktion

I farmakokinetiska studier av patienter med nedsatt leverfunktion sågs en ökning av 

absolut biotillgänglighet upp till nästan 100 %. Halveringstiden för eliminationsfasen är inte 

förändrad hos patienter med leverinsufficiens.

5.3Prekliniska säkerhetsuppgifter

I prekliniska säkerhetsstudier där telmisartan och hydroklortiazid samtidigt tillfördes till 

normotensiva råttor och hundar, hade doser jämförbara med den kliniska dosen inga 

ytterligare effekter, jämfört med de som observerats med endera substansen enbart. De 

toxikologiska fynd som observerats har ingen relevans för behandling av människor.

80 mg/25 mg:

Ingaytterligareprekliniskastudier hargenomförtsför den fastakombinationsprodukten80 mg/25

mg.I tidigareprekliniskasäkerhetsstudier därtelmisartanoch hydroklortiazidsamtidigttillfördes

tillnormotensivaråttoroch hundar, hadedoser jämförbaramedden kliniskadosen ingaytterligare

effekter, jämförtmed desomobserveratsmed enderasubstansen enbart.Detoxikologiskafynd som

observeratshar ingenrelevansför behandling avmänniskor.

Följande toxikologiska fynd är välkända från prekliniska studier med ACE­hämmare och 

angiotensin II­antagonister: minskning av röda blodkroppsparametrar (erytrocyter, 

hemoglobin, hematokrit), förändringar i renal hemodynamik (ökat blodurea och kreatinin), 

ökad reninaktivitet i plasma, hypertrofi/ hyperplasi i de juxtaglomerulära cellerna och 

gastrointestinala skador. Gastrointestinala sår kunde motverkas/förbättras genom tillägg av 

oralt given koksaltlösning och gemensamma burar. Hos hund sågs dilatation och atrofi av 

renala tubuli. Dessa fynd anses bero på den farmakologiska aktiviteten av telmisartan.

Inga tydliga bevis på teratogen effekt har observerats, men vid toxiska dosnivåer av 

telmisartan observerades en effekt på den postnatala utvecklingen hos avkomman såsom 

lägre kroppsvikt och fördröjning till att öppna ögonen.

Telmisartan visade inga tecken på mutagenicitet eller relevant klastogen aktivitet i  in vitro 

studier och inga tecken på carcinogenicitet hos råtta och mus. Studier med hydroklortiazid 

har visat på en genotoxisk eller carcinogen effekt i vissa experimentella modeller. 

Omfattande klinisk erfarenhet har inte kunnat påvisa något samband mellan behandling 

med hydroklortiazid och tumörsjukdom.

För fostertoxiska effekter av kombinationen telmisartan/hydroklortiazid, se avsnitt 4.6

Läkemedelsverket2015-05-22

6. FARMACEUTISKA UPPGIFTER

6.1 Förteckning över hjälpämnen

Magnesiumstearat (E470b)

Kaliumhydroxid

Meglumin

Povidon

Natriumstärkelseglykolat (typ A)

Mikrokristallin cellulosa

Mannitol (E421)

6.2Inkompatibiliteter

Ej relevant.

6.3Hållbarhet

För Al/Al blister:

2 år.

För Al/PVDC Tristar blister:

1 år.

Läkemedelsverket2015-05-22

6.4Särskilda förvaringsanvisningar

För Al/Al blister och HDPE burk:

Inga särskilda förvaringsanvisningar.

För Al/PVDC Tristar blister:

Förvaras vid högst 30 °C

6.5Förpackningstyp och innehåll 

Blister med: 14, 28, 56 eller 98 tabletter.

Eventuellt kommer inte alla förpackningsstorlekar att marknadsföras.

6.6Särskilda anvisningar för destruktion 

Inga särskilda anvisningar.

7. INNEHAVARE AV GODKÄNNANDE FÖR FÖRSÄLJNING

STADA Arzneimittel AG

Stadastrasse 2­18,

61118 Bad Vilbel

Tyskland

8. NUMMER PÅ GODKÄNNANDE FÖR FÖRSÄLJNING 

40 mg/12,5 mg: 48997

80 mg/12,5 mg:48998

80 mg/25 mg:48999

9. DATUM FÖR FÖRSTA GODKÄNNANDE/FÖRNYAT GODKÄNNANDE 

2013­12­16

10.DATUM FÖR ÖVERSYN AV PRODUKTRESUMÉN

2015­05­22

Liknande Produkter

Sök varningar relaterade till denna produkt

Visa dokumenthistorik

Dela den här informationen