Valsartan + Hidroclorotiazida Mylan 160 mg + 12.5 mg Comprimido revestido por película

Portugal - português - INFARMED (Autoridade Nacional do Medicamento e Produtos de Saúde)

Compre agora

MMR MMR (MMR)

28-02-2019

Ingredientes ativos:
Valsartan + Hidroclorotiazida
Disponível em:
Mylan, Lda.
Código ATC:
C09DA03
DCI (Denominação Comum Internacional):
Valsartan + Hydrochlorothiazide
Dosagem:
160 mg + 12.5 mg
Forma farmacêutica:
Comprimido revestido por película
Composição:
Valsartan 160 mg ; Hidroclorotiazida 12.5 mg
Via de administração:
Via oral
Unidades em pacote:
Blister - 14 unidade(s)
Classe:
3.4.1.1 - Tiazidas e análogos3.4.2.2 - Antagonistas dos receptor
Tipo de prescrição:
MSRM Medicamento sujeito a receita médica
Grupo terapêutico:
Genérico
Área terapêutica:
valsartan and diuretics
Indicações terapêuticas:
Duração do Tratamento: Longa Duração
Resumo do produto:
Blister 14 unidade(s) Comercializado Número de Registo: 5466073 CNPEM: 50038389 CHNM: 10064617 Grupo Homogéneo: Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [1-20] unidades; Blister 56 unidade(s) Comercializado Número de Registo: 5466115 CNPEM: 50038400 CHNM: 10064617 Grupo Homogéneo: Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [21-60] unidades; Blister 28 unidade(s) Não Comercializado Número de Registo: 5466107 CNPEM: 50038397 CHNM: 10064617 Grupo Homogéneo: N/A
Status de autorização:
Autorizado
Número de autorização:
NL/H/2360/002/DC
Data de autorização:
2012-06-11

APROVADO EM

28-02-2019

INFARMED

Folheto informativo: Informação para o utilizador

Valsartan + Hidroclorotiazida Mylan 80 mg/12,5 mg comprimidos revestidos por

película

Valsartan + Hidroclorotiazida Mylan 160 mg/12,5 mg comprimidos revestidos por

película

Valsartan + Hidroclorotiazida Mylan 160 mg/25 mg comprimidos revestidos por

película

valsartan/hidroclorotiazida

Leia com atenção todo este folheto antes de começar a tomar este medicamento,

pois contém informação importante para si.

Conserve este folheto. Pode ter necessidade de o ler novamente.

Caso ainda tenha dúvidas, fale com o seu médico ou farmacêutico.

Este medicamento foi receitado apenas para si. Não deve dá-lo a outros. O

medicamento pode ser-lhes prejudicial mesmo que apresentem os mesmos sinais de

doença.

Se tiver quaisquer efeitos secundários, incluindo possíveis efeitos secundários

não indicados neste folheto, fale com o seu médico ou farmacêutico. Ver secção 4.

O que contém este folheto:

O que é Valsartan + Hidroclorotiazida Mylan e para que é utilizado

O que precisa de saber antes de tomar Valsartan + Hidroclorotiazida Mylan

Como tomar Valsartan + Hidroclorotiazida Mylan

Efeitos secundários possíveis

Como conservar Valsartan + Hidroclorotiazida Mylan

Conteúdo da embalagem e outras informações

O que é Valsartan + Hidroclorotiazida Mylan e para que é utilizado

Valsartan + Hidroclorotiazida Mylan comprimidos revestidos por película contém duas

substâncias ativas denominadas valsartan e hidroclorotiazida. Ambas as substâncias

ajudam a controlar a pressão arterial elevada (hipertensão).

9DOVDUWDQSHUWHQFHDXPDFODVVHGHPHGLFDPHQWRVFRQKHFLGRVFRPR

ಯDQWDJRQLVWDVGRVUHFHWRUHVGDDQJLRWHQVLQD,,ರTXHDMXGDPDFRQWURODUD

SUHVV¥RDUWHULDOHOHYDGD$DQJLRWHQVLQD,,«XPDVXEVW¤QFLDSURGX]LGDSHOR

RUJDQLVPRTXHSURYRFDFRQVWUL©¥RGRVYDVRVVDQJX¯QHRVLQGX]LQGRDVVLPXP

DXPHQWRGDSUHVV¥RDUWHULDO9DOVDUWDQDWXDEORTXHDQGRRHIHLWRGDDQJLRWHQVLQD

,,&RQVHTXHQWHPHQWHRVYDVRVVDQJX¯QHRVGLODWDPHDSUHVV¥RDUWHULDOGLPLQXL

+LGURFORURWLD]LGDSHUWHQFHDXPJUXSRGHPHGLFDPHQWRVGHQRPLQDGRVGLXU«WLFRV

WLD]¯GLFRV$KLGURFORURWLD]LGDDXPHQWDRIOX[RGHXULQDRTXHWDPE«PUHGX]D

SUHVV¥RDUWHULDO

APROVADO EM

28-02-2019

INFARMED

Valsartan + Hidroclorotiazida Mylan é utilizado no tratamento da pressão arterial

elevada quando esta não está adequadamente controlada com uma substância

tomada individualmente.

A pressão arterial elevada aumenta a sobrecarga do coração e artérias. Se não for

tratada, pode provocar lesões nos vasos sanguíneos do cérebro, coração e rins

podendo dar origem a um acidente vascular cerebral (AVC), insuficiência cardíaca ou

insuficiência renal. A pressão arterial elevada aumenta o risco de ataques de

coração. A redução da pressão arterial para valores normais reduz o risco de

desenvolvimento destas doenças.

O que precisa de saber antes de tomar Valsartan + Hidroclorotiazida Mylan

Não tome Valsartan + Hidroclorotiazida Mylan:

se tem alergia ao valsartan, hidroclorotiazida, derivados de sulfonamida

(substâncias quimicamente relacionadas com hidroclorotiazida) ou a qualquer outro

componente do Valsartan + Hidroclorotiazida Mylan (indicados na secção 6).

se estiver grávida de mais de 3 meses (também é melhor evitar tomar

Valsartan + Hidroclorotiazida Mylan no início da gravidez – ver secção de gravidez).

se sofrer de doença hepática grave.

se sofrer de doença renal grave.

se for incapaz de urinar.

se estiver a fazer diálise.

se os níveis de potássio ou sódio no sangue forem mais baixos do que o

normal ou se o nível de cálcio no sangue for superior ao normal apesar de

tratamento.

se tiver gota.

se tem diabetes ou compromisso da função renal e se está a ser tratado com

aliscireno, para baixar a pressão arterial.

Se algum destes casos se aplicar a si, não tome este medicamento e consulte o seu

médico.

Advertências e precauções

Fale com o seu médico ou farmacêutico antes de tomar Valsartan + Hidroclorotiazida

Mylan:

caso tenha tido cancro da pele ou se desenvolver uma lesão cutânea

inesperada durante o tratamento. O tratamento com hidroclorotiazida, no caso

particular da utilização de doses elevadas a longo prazo, pode aumentar o risco de

alguns tipos de cancro da pele e do lábio (cancro da pele não-melanoma). Proteja a

sua pele contra a exposição solar e a radiação ultravioleta, enquanto estiver a tomar

Valsartan + Hidroclorotiazida Mylan.

se estiver a tomar medicamentos poupadores de potássio, suplementos de

potássio ou substitutos salinos que contenham potássio ou outros medicamentos que

aumentem a quantidade de potássio no sangue, tais como heparina. O seu médico

pode

necessidade

verificar

nível

potássio

sangue

regularidade.- se tiver antecedentes de alergia às sulfonamidas ou penicilina

se tiver níveis baixos de potássio no sangue.

se tiver diarreia ou vómitos graves.

se estiver a tomar doses elevadas de diuréticos.

APROVADO EM

28-02-2019

INFARMED

se sofrer de doença cardíaca grave.

se sofrer de estreitamento da artéria renal.

se tiver sido submetido recentemente a transplante renal.

se sofrer de hiperaldosteronismo. Trata-se de uma doença em que as

glândulas suprarrenais produzem a hormona aldosterona em excesso. Se isto se

aplicar a si, o uso de Valsartan + Hidroclorotiazida Mylan não é recomendado.

se sofrer de doença renal ou hepática.

se tiver febre, erupção na pele e dor nas articulações, que possam ser

sintomas de lúpus eritematoso sistémico (LES, uma doença autoimune).

se tiver diabetes, gota, níveis elevados de colesterol ou gordura no sangue.

se tiver tido reações alérgicas com outros fármacos para redução da pressão

arterial desta classe (antagonistas do recetor da angiotensina II) ou se tiver alergia

ou asma.

pode provocar aumento da sensibilidade da pele ao sol.

tem que informar o seu médico se pensa que está (ou pode vir a estar).

Valsartan + Hidroclorotiazida Mylan não é recomendado no início da gravidez e não

pode ser tomado se tiver mais de 3 meses de gravidez porque pode causar lesões

graves no seu bebé se for utilizado naquela fase (ver secção de gravidez).

se está a tomar algum dos seguintes medicamentos para tratar a pressão

arterial elevada:

um inibidor da ECA (por exemplo enalapril, lisinopril, ramipril), em particular se tiver

problemas nos rins relacionados com diabetes

aliscereno

O seu médico pode verificar a sua função renal, pressão arterial e a quantidade de

eletrólitos (por exemplo, o potássio) no seu sangue em intervalos regulares.

Ver também a informação sob o título “Não tome Valsartan + Hidroclorotiazida

Mylan”

Crianças e adolescentes

Não se recomenda a utilização de Valsartan + Hidroclorotiazida Mylan em crianças e

adolescentes (com idade inferior a 18 anos).

Outros medicamentos e Valsartan + Hidroclorotiazida Mylan

Informe

seu médico

farmacêutico se

estiver

tomar

ou tiver tomado

recentemente ou se vier a tomar outros medicamentos.

O efeito do tratamento pode ser influenciado se Valsartan + Hidroclorotiazida Mylan

for tomado com determinados medicamentos. Pode ser necessário alterar a dose,

tomar outras precauções ou, nalguns casos, interromper o tratamento com um dos

medicamentos. Esta situação aplica-se aos seguintes medicamentos:

lítio, um medicamento utilizado no tratamento de certos tipos de doença

psiquiátrica

medicamentos que afetam ou possam ser afetados pelos níveis de potássio no

sangue, tais como digoxina, um medicamento para controlar o ritmo cardíaco, alguns

medicamentos antipsicóticos e antidepressivos.

medicamentos que possam aumentar a quantidade de potássio no sangue,

tais

como

suplementos

potássio,

substitutos

salinos

contendo

potássio,

medicamentos poupadores de potássio, heparina

medicamentos que possam reduzir a quantidade de potássio no sangue, tais

como corticosteroides, alguns laxantes

APROVADO EM

28-02-2019

INFARMED

diuréticos (comprimidos de água), medicamentos para tratamento da gota,

tais

como

alopurinol,

suplementos

terapêuticos

vitamina

cálcio,

medicamentos para tratamento da diabetes (medicamentos orais ou insulina)

outros medicamentos utilizados para baixar a pressão arterial tais como,

bloqueadores

beta

metildopa

medicamentos

estreitem

vasos

sanguíneos ou estimulem o coração tais como noradrenalina ou adrenalina

medicamentos que aumentem os níveis de açúcar no sangue, tais como

diazóxido

medicamentos

para

tratamento

cancro

tais

como,

metotrexato

ciclofosfamida

analgésicos

medicamentos para a artrite

medicamentos relaxantes musculares tais como tubocurarina

medicamentos anticolinérgicos tais como atropina ou biperideno

amantadina (um medicamento utilizado para prevenir a gripe)

colestiramina e colestipol (medicamentos utilizados para tratamento de níveis

elevados de gorduras no sangue)

ciclosporina, um medicamento utilizado no transplante de órgãos para evitar

a rejeição dos órgãos

barbitúricos

narcóticos

(medicamentos

para

dormir

analgésicos,

utilizados durante uma cirurgia, por exemplo)

antiepiléticos

carbamazepina,

medicamento

para

tratamento

convulsões

rifampicina, um medicamento para tratar a tuberculose

ritonavir, um medicamento utilizado para tratar a infecção por VIH

medicamentos que afetam a motilidade gástrica como a cisaprida

se está a tomar um inibidor da ECA ou aliscireno (ver também informações

sob os títulos “Não tome Valsartan + Hidroclorotiazida Mylan” e “Advertências e

precauções”).

Valsartan + Hidroclorotiazida Mylan com alimentos, bebidas e álcool

Pode tomar Valsartan + Hidroclorotiazida Mylan com ou sem alimentos.

Evite beber bebidas alcoólicas enquanto não tiver falado com o seu médico. O álcool

pode fazer com que a pressão arterial baixe mais e/ou pode aumentar o risco de

ficar tonto ou desmaiar.

Gravidez e amamentação

Gravidez

Se está grávida, se pensa estar grávida ou planeia engravidar, consulteo seu médico

antes de tomar este medicamento. Normalmente o seu médico irá aconselhá-la a

interromper

tratamento

Valsartan

Hidroclorotiazida

Mylan

antes

engravidar ou assim que você saiba que está grávida e irá aconselhá-la a tomar

outro medicamento em substituição de Valsartan + Hidroclorotiazida Mylan.

Valsartan + Hidroclorotiazida Mylan não é recomendado no início da gravidez e não

pode ser tomado se tiver mais de 3 meses de gravidez porque pode causar lesões

graves no seu bebé se for utilizado depois do terceiro mês de gravidez.

Amamentação

Se está a amamentar ou se vai começar a amamentar, consulte o seu médico antes

tomar

este

medicamento

Valsartan

Hidroclorotiazida

Mylan

não

recomendado para mães que estão a amamentar e o seu médico poderá escolher

APROVADO EM

28-02-2019

INFARMED

outro tratamento para si se desejar amamentar, especialmente se o seu bebé for

recém-nascido ou for prematuro.

Condução de veículos e utilização de máquinas

Antes de conduzir um veículo, utilizar ferramentas ou máquinas, ou desempenhar

outras tarefas que requeiram concentração, certifique-se de que sabe como reage

efeitos

Valsartan

Hidroclorotiazida

Mylan.

como

outros

medicamentos utilizados no tratamento da pressão arterial elevada, Valsartan +

Hidroclorotiazida

Mylan

pode,

ocasionalmente,

provocar

tonturas

afetar

capacidade de concentração.

Valsartan + Hidroclorotiazida Mylan contém lactose.

Se foi informado pelo seu médico de que tem intolerância a alguns açúcares (por

exemplo, lactose), contacte o seu médico antes de tomar este medicamento.

Como tomar Valsartan + Hidroclorotiazida Mylan

Tome

este

medicamento

exatamente

como

indicado

pelo

médico

farmacêutico. Fale com o seu médico ou farmacêutico se tiver dúvidas.

A dose recomendada de Valsartan + Hidroclorotiazida Mylan é de um comprimido por

dia. O medicamento deve ser sempre tomado à mesma hora todos os dias,

geralmente de manhã. O seu médico dir-lhe-á exatamente quantos comprimidos de

Valsartan + Hidroclorotiazida Mylan deve tomar. Dependendo da sua resposta ao

tratamento, o seu médico poderá receitar uma dose mais elevada ou mais baixa.

Utilização em crianças

Valsartan + Hidroclorotiazida Mylan não é recomendadoem crianças e adolescentes

de idade inferior a 18 anos.

Via e modo de administração

Pode tomar este medicamento com ou sem alimentos. Engula os comprimidos com

um copo de água.

Duração do tratamento

Não altere a dose nem deixe de tomar os comprimidos sem consultar o seu médico.

Frequentemente, os doentes com hipertensão arterial não notam quaisquer sinais

deste

problema.

Muitos

sentem-se

perfeitamente

normais.

Torna-se

assim

fundamental que cumpra o calendário de consultas com o seu médico, mesmo

quando se sente bem.

Se tomar mais Valsartan + Hidroclorotiazida Mylan do que deveria

Se sentir tonturas graves e/ou desmaio, deite-se e contacte imediatamente o seu

médico. Se acidentalmente tomou demasiados comprimidos, contacte o seu médico,

farmacêutico ou o serviço de urgência do hospital.

Caso se tenha esquecido de tomar Valsartan + Hidroclorotiazida Mylan

Caso se tenha esquecido de tomar uma dose tome-a assim que se lembrar. No

entanto, se estiver quase na hora de tomar a dose seguinte, não tome a dose que se

esqueceu. Não tome uma dose a dobrar para compensar uma dose que se esqueceu

de tomar.

APROVADO EM

28-02-2019

INFARMED

Se parar de tomar Valsartan + Hidroclorotiazida Mylan

Interromper o tratamento com Valsartan + Hidroclorotiazida Mylan pode agravar a

sua pressão arterial. Não deixe de tomar o medicamento a menos que seja o seu

médico a dizer-lhe que o faça.

Caso ainda tenha dúvidas sobre a utilização deste medicamento, fale com o seu

médico ou farmacêutico.

Efeitos secundários possíveis

Como todos os medicamentos, este medicamento pode causar efeitos secundários,

embora estes não se manifestem em todas as pessoas.

Alguns

efeitos

secundários

podem

graves

requerem

assistência

médica

imediata. Consulte imediatamente o seu médico ou dirija-se ao serviço de urgência

do hospital se tiver sintomas de angioedema, como por exemplo:

inchaço da face, língua ou faringe

dificuldade em engolir

urticária e dificuldades em respirar

erupção cutânea, que pode formar bolhas, semelhantes a pequenos alvos

(manchas escuras centrais rodeado por uma área mais pálida, com anel escuro ao

redor da borda) (eritema multiforme)

Os seguintes efeitos secundários foram observados durante o tratamento com

Valsartan + Hidroclorotiazida Mylan com as seguintes frequências:

Efeitos secundários pouco frequentes: podem afetar até 1 em 100 pessoas

tosse

pressão arterial baixa

sensação de cabeça oca

desidratação (com sintomas de sede, boca e língua seca, micção pouco

frequente, urina de coloração escura ou pele seca)

dor muscular

cansaço

formigueiro ou dormência

visão turva

ruídosnos ouvidos tais como assobios ou zumbidos

Efeitos secundários muito raros: podem afetar até 1 em 10.000 pessoas

tonturas

diarreia

dor nas articulações

Desconhecidos: frequência não pode ser calculada a partir dos dados disponíveis

dificuldade em respirar

redução acentuada do fluxo urinário

nível baixo de sódio no sangue (por vezes com náuseas, cansaço, confusão,

mal-estar, convulsões)

nível baixo de potássio no sangue (por vezes com fraqueza muscular, cãibras,

arritmias cardíacas)

APROVADO EM

28-02-2019

INFARMED

nível baixo de glóbulos brancos no sangue (com sintomas como febre,

infeções da pele, dor de garganta ou úlceras na boca devidas a infeções, fraqueza)

aumento do nível de bilirrubina no sangue (que pode, em casos graves,

provocar pele e olhos amarelos)

aumento do nível de azoto ureico e de creatinina no sangue (que pode ser

sugestivo de função renal anormal)

aumento do nível de ácido úrico no sangue (que pode, em casos graves,

provocar gota)

síncope (desmaio)

Efeitos

secundários

valsartan

hidroclorotiazida

isoladamente,

não

observados com Valsartan + Hidroclorotiazida Mylan:

Valsartan

Efeitos secundários pouco frequentes: podem afetar até 1 em 100 utilizadores:

sensação de girar

dor abdominal

Desconhecidos: a frequência não pode ser calculada a partir dos dados disponíveis

erupção cutânea com ou sem comichão associados a alguns dos seguintes

sinais ou sintomas: febre, dor nas articulações, dor muscular, nódulos linfáticos

inchados e/ou sintomas gripais.

erupção cutânea, manchas vermelho-arroxeadas, febre, comichão (sintomas

de inflamação dos vasos sanguíneos)

baixo nível de plaquetas no sangue (acompanhada por vezes de hemorragias

ou hematomas anormais)

aumento

nível

potássio

sangue

(por

vezes

espasmos

musculares, ritmo cardíaco anormal)

reações alérgicas (com sintomas como erupção cutânea, comichão, urticária,

dificuldade em respirar ou engolir, tonturas)

inchaço sobretudo da face e garganta, erupção cutânea, comichão

elevação dos valores da função hepática

diminuição do nível de hemoglobina e diminuição da percentagem de glóbulos

vermelhos no sangue (que podem ambos, em casos graves, provocar anemia).

insuficiência renal

Hidroclorotiazida

Efeitos secundários muito frequentes: podem afetar mais de 1 em 10 pessoas

níveis

baixos

potássio

sangue,

aumento

lípidos

sangue

(principalmente em doses elevadas)

Efeitos secundários frequentes: podem afetar até 1 em 10 pessoas

erupção cutânea com comichão e outras formas de erupção cutânea

baixos níveis de sódio, baixos níveis de magnésio no sangue

níveis elevados de ácido úrico

apetite reduzido

náuseas ligeiras e vómitos

desmaio, desmaio ao levantar-se

impotência

APROVADO EM

28-02-2019

INFARMED

Efeitos secundários raros: podem afetar até 1 em 1.000 pessoas

inchaço e bolhas na pele (devido ao aumento da sensibilidade ao sol)

obstipação, desconforto do estômago ou dos intestinos, diarreia, distúrbios do

fígado (olhos e pele amarela)

batimentos cardíacos irregulares

níveis elevados de cálcio, nível elevado de açúcar no sangue, excreção de

açúcar na urina, agravamento do estado metabólico do diabético

dor de cabeça, tonturas, formigueiro ou dormência nas mãos e nos pés

perturbações do sono

tristeza (depressão)

níveis

baixos

plaquetas

sangue

(por

vezes

hemorragia

hematomas sob a pele)

distúrbios visuais

Efeitos secundários muito raros: podem afetar até 1 em 10.000 pessoas

inflamação dos vasos sanguíneos com sintomas como erupção cutânea,

manchas vermelho-arroxeadas, febre

prurido ou vermelhidão da pele

bolhas nos lábios, olhos ou boca

descamação da pele

febre

erupção cutânea facial associada a dor nas articulações

anomalia muscular

febre (lúpus eritematoso cutâneo)

dor intensa na região superior do abdómen; ausência ou níveis baixos das

várias células do sangue

reações alérgicas graves

dificuldade em respirar

infeção pulmonar; falta de ar

uma alteração metabólica que resulta em perda de cloro do organismo

Desconhecido: a frequência não pode ser calculada a partir dos dados disponíveis

diminuição grave do número de células do sangue que pode causar fraqueza,

fazer nódoas negras ou infecções com mais facilidade

pressão ocular elevada (glaucoma)

disfunção renal, insuficiência renal aguda

febre, fraqueza

espasmos musculares

Cancro da pele e do lábio (cancro da pele não-melanoma)

Comunicação de efeitos indesejáveis

Se tiver quaisquer efeitos indesejáveis, incluindo possíveis efeitos indesejáveis não

indicados neste folheto, fale com o seu médico, ou farmacêutico. Também poderá

comunicar efeitos indesejáveis diretamente ao INFARMED, I.P. através dos contactos

abaixo.

comunicar

efeitos

indesejáveis,

estará

ajudar

fornecer

mais

informações sobre a segurança deste medicamento.

Sítio da internet: http://www.infarmed.pt/web/infarmed/submissaoram

(preferencialmente) ou através dos seguintes contactos:

Direção de Gestão do Risco de Medicamentos

Parque da Saúde de Lisboa, Av. Brasil 53

1749-004 Lisboa

APROVADO EM

28-02-2019

INFARMED

Tel: +351 21 798 73 73

Linha do Medicamento: 800222444 (gratuita)

E-mail: farmacovigilancia@infarmed.pt

Como conservar Valsartan + Hidroclorotiazida Mylan

Manter este medicamento fora da vista e do alcance das crianças.

Não utilize este medicamento após o prazo de validade impresso na embalagem

exterior, rótulo, blister ou frasco, após EXP. O prazo de validade corresponde ao

último dia do mês indicado.

Utilizar no prazo de 100 dias após a abertura do frasco. Uma vez aberto, manter o

frasco bem fechado.

O medicamento não necessita de precauções especiais de conservação. Não utilize a

embalagem de Valsartan + Hidroclorotiazida Mylan se verificar que a embalagem se

encontra danificada ou apresenta sinais de adulteração.

Não deite fora quaisquer medicamentos na canalização ou no lixo doméstico.

Pergunte ao seu farmacêutico como deitar fora os medicamentos que já não utiliza.

Estas medidas ajudarão a proteger o ambiente.

Conteúdo da embalagem e outras informações

Qual a composição de Valsartan + Hidroclorotiazida Mylan

As substâncias ativas são o valsartan e a hidroclorotiazida.

Cada comprimido de 80 mg/12,5 mg contém 80 mg de valsartan e 12,5 mg

de hidroclorotiazida.

Cada comprimido de 160 mg/12,5 mg contém 160 mg de valsartan e 12,5 mg

de hidroclorotiazida.

Cada comprimido de 160 mg/25 mg contém 160 mg de valsartan e 25 mg de

hidroclorotiazida.

Os outros componentes são: sílica coloidal anidra, estearato de magnésio,

laurilsulfato de sódio, celulose microcristalina, amido de milho pré-gelatinizado,

lactose mono-hidratada, crospovidona, povidona e estearato de magnésio.

O revestimento por película contém: hipromelose, dióxido de titânio (E171),

macrogol, talco e óxido de ferro vermelho (E172).

Qual o aspeto de Valsartan + Hidroclorotiazida Mylan e conteúdo da embalagem

Valsartan + Hidroclorotiazida Mylan 80 mg/12,5 mg: comprimido laranja-claro, oval,

biconvexo, revestido por película, com impressão "VH1" numa face e "M" na outra

face.

Valsartan + Hidroclorotiazida Mylan 160 mg/12,5 mg: comprimido avermelhado,

oval, biconvexo, revestido por película, com impressão "VH2" numa face e "M" na

outra face.

Valsartan + Hidroclorotiazida Mylan 160 mg/25 mg: comprimido castanho, oval,

biconvexo, revestido por película, com impressão "VH3" numa face e "M" na outra

face.

APROVADO EM

28-02-2019

INFARMED

Valsartan + Hidroclorotiazida Mylan está disponível em blisters de 7, 10, 14, 28, 30,

56, 60, 84, 90 e 98 comprimidos; embalagem blister calendário de 28 comprimidos e

embalagem em frasco de 56, 98, 100, 200, 250 e 500 comprimidos.

Valsartan + Hidroclorotiazida Mylan também está disponível em embalagem múltipla

com blister, contendo 98 comprimidos, 2 embalagens (cada uma contendo 49

comprimidos), apenas para a dosagem de 80 mg/12,5 mg, 160mg/12,5mg e 160

mg/25 mg.

É possível que não sejam comercializadas todas as apresentações.

Titular da Autorização de Introdução no Mercado e Fabricante

Titular da Autorização de Introdução no Mercado

Mylan, Lda.

Av. D. João II, Edifício Atlantis, N.º 44C - 7.3 e 7.4

1990-095 Lisboa

Fabricante

McDermott Laboratories Ltd t/a Gerard Laboratories,

35/36 Baldoyle Industrial Estate, Grange Road, Dublin 13

Irlanda

Generics UK Ltd

Station Close

Potters Bar - Hertfordshire

Reino Unido

Mylan Hungary Kft

H-2900 Komárom

Mylan utca 1

Hungria

Este

medicamento

encontra-se

autorizado

Estados

Membros

Espaço

Económico Europeu (EEE) sob as seguintes denominações:

Áustria

Valsartan/HCT Arcana

Bélgica

Co-Valsartan Mylan

Dinamarca

Valzydroc

Finlândia

Valzydroc

França

VALSARTAN HYDROCHLOROTHIAZIDE MYLAN PHARMA

Alemanha

Valsartan/HCT Mylan

Grécia

Valsartan + HCTZ /Mylan

Hungria

Valsartan HCT Mylan

Luxemburgo

Co-Valsartan Mylan

Noruega

Valzydroc

Polónia

Valsartan HCT Mylan

Portugal

Valsartan + Hidroclorotiazida Mylan

Espanha

Valsartán Hidroclorotiazida Mylan

Suécia

Valzydroc

APROVADO EM

28-02-2019

INFARMED

RESUMO DAS CARACTERÍSTICAS DO MEDICAMENTO

NOME DO MEDICAMENTO

Valsartan + Hidroclorotiazida Mylan 80 mg /12,5 mg comprimidos revestidos por

película

Valsartan + Hidroclorotiazida Mylan 160 mg /12,5 mg comprimidos revestidos por

película

Valsartan + Hidroclorotiazida Mylan 160 mg /25 mg comprimidos revestidos por

película

COMPOSIÇÃO QUALITATIVA E QUANTITATIVA

Valsartan + Hidroclorotiazida Mylan 80 mg /12,5 mg comprimidos revestidos por

película

Cada comprimido contém 80 mg de valsartan e 12,5 mg de hidroclorotiazida.

Excipiente com efeito conhecido: 51,950 mg de lactose mono-hidratada.

Valsartan + Hidroclorotiazida Mylan 160 mg /12,5 mg comprimidos revestidos por

película

Cada comprimido contém 160 mg de valsartan e 12,5 mg de hidroclorotiazida.

Excipiente com efeito conhecido: 103,900 mg de lactose mono-hidratada.

Valsartan + Hidroclorotiazida Mylan 160 mg /25 mg comprimidos revestidos por

película

Cada comprimido contém 160 mg de valsartan e 25 mg de hidroclorotiazida.

Excipiente com efeito conhecido: 103,900 mg de lactose mono-hidratada.

Lista completa de excipientes, ver secção 6.1.

FORMA FARMACÊUTICA

Comprimido revestido por película

Valsartan + Hidroclorotiazida Mylan 80 mg /12,5 mg comprimidos revestidos por

película

Comprimido revestido por película laranja-claro, oval, biconvexo (12,5 mm x 6,4

mm), com impressão "VH1" num lado do comprimido e "M" no outro lado.

Valsartan + Hidroclorotiazida Mylan 160 mg /12,5 mg comprimidos revestidos por

película

Comprimido revestido por película avermelhado, oval, biconvexo (16,1 mm x 7,6

mm), com impressão "VH2" num lado do comprimido e "M" no outro lado.

APROVADO EM

28-02-2019

INFARMED

Valsartan + Hidroclorotiazida Mylan 160 mg /25 mg comprimidos revestidos por

película

Comprimido revestido por película castanho, oval, biconvexo (16,1 mm x 7,6 mm),

com impressão "VH3" num lado do comprimido e "M" no outro lado.

INFORMAÇÕES CLÍNICAS

Indicações terapêuticas

Tratamento da hipertensão essencial em adultos.

A associação de dose fixa de Valsartan + Hidroclorotiazida Mylan está indicada em

doentes cuja pressão arterial não esteja adequadamente controlada com valsartan

ou hidroclorotiazida em monoterapia.

Posologia e modo de administração

Posologia

A dose recomendada de Valsartan + Hidroclorotiazida Mylan é de um comprimido

revestido

película

dia.

recomendada

titulação

dose

componentes individuais. Em cada caso, a titulação da dose dos componentes

individuais para a dosagem seguinte deve ser acompanhada de modo a reduzir o

risco de hipotensão e outros acontecimentos adversas.

Quando for clinicamente apropriado, pode ser considerada a mudança direta da

monoterapia para a associação de dose fixa em doentes cuja pressão arterial não

esteja

adequadamente

controlada

valsartan

hidroclorotiazida

monoterapia,

desde

sequência

titulação

dose

componentes

individuais seja seguida.

A resposta clínica a Valsartan + Hidroclorotiazida Mylan deve ser avaliada após o

início da terapêutica e se a pressão arterial se mantiver não controlada, a dose pode

ser aumentada através do aumento de qualquer um dos componentes até à dose

máxima de 320 mg/25 mg de Valsartan + Hidroclorotiazida Mylan.

O efeito anti-hipertensivo está substancialmente presente no espaço de 2 semanas.

Na maior parte dos doentes, os efeitos máximos são observados no período de 4

semanas. No entanto, alguns doentes podem necessitar de um tratamento de 4-8

semanas. Isto deve ser tido em consideração durante a titulação de dose.

Modo de administração

Valsartan + Hidroclorotiazida Mylan comprimidos pode ser tomado com ou sem

alimentos e deve ser administrado com água.

Populações especiais

Compromisso renal

APROVADO EM

28-02-2019

INFARMED

Não é necessário proceder a um ajuste posológico em doentes com compromisso

renal

ligeiro

moderado

(Taxa

Filtração

Glomerular

(TFG)

depuração

creatinina

≥30

ml/min).

Devido

componente

hidroclorotiazida, Valsartan

Hidroclorotiazida Mylan é contraindicado em doentes com compromisso renal grave

(GFR < 30 ml/min) e anúria (ver secções 4.3, 4.4 e 5.2).

Compromisso hepático

Em doentes com compromisso hepático ligeiro a moderado sem colestase a dose de

valsartan não deverá exceder os 80 mg (ver secção 4.4). Não é necessário ajuste da

dose de hidroclorotiazida em doentes com disfunção hepática ligeira a moderada.

Devido ao componente Valsartan + Hidroclorotiazida Mylan é contraindicado em

doentes com compromisso hepático grave ou com cirrose biliar e colestase (ver

secções 4.3, 4.4 e 5.2).

Idosos

Não é necessário ajuste da dose em doentes idosos.

População pediátricaValsartan + Hidroclorotiazida Mylan não é recomendado em

crianças com idades inferiores a 18 anos devido à falta de informação de segurança

e eficácia.

Contraindicações

-Hipersensibilidade às substâncias ativas, a outros medicamentos derivados das

sulfonamidas ou a qualquer dos excipientes mencionados na secção 6.1.

-Segundo e terceiro trimestre de gravidez (ver secções 4.4 e 4.6).

-Compromisso hepática grave, cirrose biliar e colestase.

-Compromisso renal grave (depuração da creatinina <30 ml/min), anúria.

-Hipocaliemia refratária, hiponatremia, hipercalcemia e hiperuricemia sintomática.

-O uso concomitante de Valsartan + Hidroclorotiazida Mylan com medicamentos

contendo

aliscireno

contraindicado

doentes

diabetes

mellitus

compromisso renal (TFG < 60 ml/min/1,73 m2 ) (ver secções 4.5 e 5.1).

Advertências e precauções especiais de utilização

Alterações dos eletrólitos séricos

Valsartan

Não

recomendada

a utilização

concomitante com

suplementos

potássio,

diuréticos poupadores de potássio, substitutos do sal contendo potássio ou outros

fármacos

possam

aumentar

níveis

potássio

(heparina,

etc.).

monitorização de potássio deve ser realizada apropriadamente.

Hidroclorotiazida

referida

hipocaliemia

tratamento

diuréticos

tiazídicos,

incluindo

hidroclorotiazida. Recomenda-se a monitorização frequente do potássio sérico.

O tratamento com diuréticos tiazídicos, incluindo a hidroclorotiazida, tem sido

associado

hiponatremia

alcalose

hipoclorémica.

tiazidas,

incluindo

hidroclorotiazida, aumentam a excreção urinária de magnésio, podendo provocar

APROVADO EM

28-02-2019

INFARMED

hipomagnesemia. A excreção do cálcio sofre uma redução por ação dos diuréticos

tiazídicos. Este efeito pode provocar hipercalcemia.

Tal como para qualquer doente a receber terapêutica com diuréticos, deve ser

efetuada a determinação periódica dos eletrólitos séricos em intervalos apropriados.

Doentes com depleção de sódio e/ou do volume

Os doentes tratados com diuréticos tiazídicos, incluindo a hidroclorotiazida, devem

ser monitorizados para despiste de sinais clínicos de desequilíbrio hídrico ou de

eletrólitos.

Nos doentes com depleção grave de sódio e/ou do volume, nomeadamente nos

doentes

tratados

doses

elevadas

diuréticos,

pode

ocorrer

hipotensão

sintomática

casos

raros

após

início

terapêutica

Valsartan

Hidroclorotiazida Mylan. A depleção de sódio e/ou do volume deve ser corrigida antes

de iniciar o tratamento com Valsartan + Hidroclorotiazida Mylan.

Doentes

insuficiência

cardíaca

crónica

grave

outras

situações

estimulação do sistema renina-angiotensina-aldosterona

Em doentes cuja função renal possa depender da atividade do sistema renina-

angiotensina-aldosterona (por ex., doentes com insuficiência cardíaca congestiva

grave), o tratamento com inibidores da enzima de conversão da angiotensina tem

sido associado a oligúria e/ou azotemia progressiva e, em casos raros, a insuficiência

renal aguda e/ou morte. A avaliação de doentes com insuficiência cardíaca ou após

enfarte do miocárdio devem incluir sempre a avaliação da função renal. A utilização

de Valsartan + Hidroclorotiazida Mylan em doentes com insuficiência cardíaca crónica

grave não foi estabelecida.

Não é, consequentemente, possível excluir que a inibição do sistema renina-

angiotensina-aldosterona ou a utilização de Valsartan + Hidroclorotiazida Mylan

possa

encontrar-se

associada

compromisso

função

renal.

Valsartan

Hidroclorotiazida Mylan não deve ser usado nestes doentes.

Estenose da artéria renal

Valsartan

Hidroclorotiazida

Mylan

não

deve

usado

tratamento

hipertensão em doentes com estenose arterial renal unilateral ou bilateral, ou

estenose arterial de rim solitário, uma vez que a ureia no sangue e a creatinina

sérica pode aumentar nestes doentes.

Hiperaldosteronismo primário

Doentes com hiperaldosteronismo primário não devem ser tratados com Valsartan +

Hidroclorotiazida Mylan dado que o seu sistema renina-angiotensina não está

ativado.

Estenose aórtica e da válvula mitral, miocardiopatia obstrutiva hipertrófica

APROVADO EM

28-02-2019

INFARMED

Tal como com todos os outros vasodilatadores, está indicado um cuidado especial

nos doentes que sofram de estenose aórtica ou mitral ou de miocardiopatia

obstrutiva hipertrófica (HOCM).

Compromisso renal

Não é necessário proceder a ajuste posológico nos doentes com disfunção renal com

depuração

creatinina

≥30

ml/min

(ver

secção

4.2).

Recomenda-se

monitorização periódica do potássio sérico, dos níveis de creatinina e de ácido úrico

quando Valsartan + Hidroclorotiazida Mylan é usado em doentes com disfunção

renal.

Transplante renal

Não há experiência sobre o uso seguro de Valsartan + Hidroclorotiazida Mylan em

doentes com transplante renal recente.

Compromisso hepático

Em doentes com compromisso hepático ligeiro a moderado sem colestase, Valsartan

+ Hidroclorotiazida Mylan deve ser usado com precaução (ver secções 4.2 e 5.2). As

tiazidas devem ser utilizadas com precaução em doentes com compromisso da

função hepática ou doença hepática progressiva, uma vez que alterações menores do

equilíbrio de fluidos e de eletrólitos podem precipitar coma hepático.

História de angioedema

Angioedema, incluindo edema de laringe e glote, causando obstrução das vias aéreas

e / ou inchaço da face, lábios, faringe e / ou língua tem sido reportada em doentes

tratados com valsartan; alguns destes doentes já tinham tido anteriormente uma

situação de angioedema com outros medicamentos incluindo inibidores da ECA.

Valsartan + Hidroclorot iazida Mylan deve ser imediatamente interrompido em

doentes que desenvolvam angioedema, e não deve ser re-administrado (ver secção

4.8).

Cancro da pele não-melanoma

dois

estudos epidemiológicos

baseados no

registo nacional

de cancro

Dinamarca foi observado um aumento do risco de cancro da pele não-melanoma

(NMSC) [carcinoma basocelular (BCC) e carcinoma espinocelular (SCC)] com uma

dose cumulativa crescente de exposição a hidroclorotiazida (HCTZ). A atividade

fotossensibilizadora da HCTZ pode atuar como mecanismo para o NMSC.

Os doentes em tratamento com HCTZ devem ser informados do risco de NMSC e

aconselhados a observar regularmente a sua pele. Quaisquer novas lesões da pele

suspeitas devem ser imediatamente comunicadas ao médico. Os doentes devem ser

aconselhados a tomar medidas preventivas tais como limitação da exposição à luz

solar e à radiação ultravioleta e, em caso de exposição, a utilização de proteção

adequada com vista a minimizar o risco de cancro da pele. As lesões cutâneas

suspeitas devem ser rapidamente examinadas, nomeadamente através de exames

histológicos de biópsias. A utilização de HCTZ também poderá ter que ser reavaliada

em doentes com antecedentes de NMSC (ver também secção 4.8).

Lúpus eritematoso sistémico

APROVADO EM

28-02-2019

INFARMED

sido

descrito

diuréticos

tiazídicos,

incluindo

hidroclorotiazida,

exacerbam ou ativam o lúpus eritematoso sistémico.

Outras alterações metabólicas

Os diuréticos tiazídicos, incluindo a hidroclorotiazida, podem alterar a tolerância à

glucose e aumentar os níveis séricos de colesterol, triglicéridos e ácido úrico. Em

doentes diabéticos pode ser necessário ajuste posológico de insulina ou fármacos

antidiabéticos orais.

As tiazidas podem reduzir a excreção urinária de cálcio e provocar um aumento

ligeiro e intermitente do cálcio sérico na ausência de distúrbios conhecidos no

metabolismo

cálcio.

marcada

hipercalcemia

pode

sintoma

hiperparatiroidismo subjacente. A terapêutica com tiazidas deve ser interrompida

antes de se efetuarem testes à função paratiroideia.

Fotossensibilidade

Foram notificados casos de reação de fotossensibilidade com diuréticos tiazídicos

(ver secção 4.8). Se ocorrerem reações de fotossensibilidade durante a terapêutica,

recomenda-se a interrupção do tratamento. Se for considerado essencial retomar a

administração de um diurético, recomenda-se proteger as áreas expostas ao sol ou a

UVA artificiais.

Gravidez

A terapêutica com Antagonistas dos Recetores da Angiotensina II (ARAIIs) não deve

ser iniciada durante a gravidez. A menos que a continuação da terapêutica com

ARAII seja considerada essencial, doentes que planeiem engravidar devem mudar

para terapêuticas anti-hipertensoras alternativas que tenham um perfil de segurança

estabelecido para utilização durante a gravidez. Quando a gravidez é diagnosticada a

terapêutica com ARAIIs deve ser imediatamente interrompida e, se apropriado, deve

ser iniciada terapêutica alternativa (ver secções 4.3 e 4.6).

Gerais

Deve

ter-se

cuidado

doentes

tenham

demonstrado

anteriormente

hipersensibilidade a outros agentes antagonistas dos recetores da angiotensina II. As

reações de hipersensibilidade à hidroclorotiazida são mais prováveis em doentes com

alergia e asma.

Glaucoma do Ângulo-Fechado agudo

hidroclorotiazida,

sulfonamida,

sido

associada

reação

idiossincrática que resulta numa miopia transitória aguda e glaucoma do ângulo-

fechado agudo. Os sintomas incluem um início agudo de acuidade visual diminuída

ou dor ocular e ocorrem tipicamente algumas horas a semanas antes do inicio do

fármaco. Glaucoma do ângulo fechado agudo não tratado pode levar a perda de

visão permanente.

O tratamento primário é descontinuar a hidroclorotiazida o mais rápido possível.

Pode ser necessário considerar tratamento médico ou cirúrgico imediato se a pressão

intraocular permanecer incontrolável. Os fatores de risco para o desenvolvimento de

APROVADO EM

28-02-2019

INFARMED

glaucoma

ângulo

fechado

agudo

podem

incluir

antecedentes de

alergia

sulfonamida ou à penicilina.

Duplo bloqueio do sistema renina-angiotensina-aldosterona (SRAA)

Existe evidência de que o uso concomitante de inibidores da ECA, antagonistas dos

recetores

angiotensina

aliscireno

aumenta

risco

hipotensão,

hipercaliemia e função renal diminuída (incluindo insuficiência renal aguda). Como

tal, o duplo bloqueio do SRAA através do uso combinado de inibidores da ECA,

antagonistas dos recetores da angiotensina II ou aliscireno, não é recomendado (ver

secções 4.5 e 5.1).

Se a terapêutica de duplo bloqueio for considerada absolutamente necessária, esta

só deverá ser utilizada sob a supervisão de um especialista e submetida a uma

monitorização frequente e apertada da função renal, eletrólitos e pressão arterial. Os

inibidores da ECA e os antagonistas dos recetores da angiotensina II não devem ser

utilizados concomitantemente em doentes com nefropatia diabética.

A utilização de aliscireno em associação com Valsartan + Hidroclorotiazida Mylan é

contraindicada em doentes com diabetes mellitus ou compromisso renal (TFG < 60

ml/min/1,73 m2)(ver secção 4.3).

Valsartan

Hidroclorotiazida

Mylan

contém

lactose.

Doentes

problemas

hereditários raros de intolerância à galactose, deficiência de lactase ou malabsorção

de glucose-galactose não devem tomar este medicamento.

Interações medicamentosas e outras formas de interação

Interações relacionadas tanto com valsartan como com hidroclorotiazida

Utilização concomitante não recomendada

Lítio

Foram relatados aumentos reversíveis das concentrações séricas do lítio e da

toxicidade durante a administração concomitante de lítio com inibidores da ECA,

antagonistas do recetor da angiotensina II ou e tiazidas, incluindo hidroclorotiazida.

Dado que a depuração renal do lítio é reduzida pelas tiazidas o risco de toxicidade do

lítio pode, presumivelmente, aumentar ainda mais com Valsartan + Hidroclorotiazida

Mylan..

Caso

esta

associação

seja

necessária,

recomenda-se

monitorização

cuidadosa dos níveis séricos de lítio.

Utilização concomitante que requer precaução

Outros fármacos anti-hipertensores

Valsartan + Hidroclorotiazida Mylan pode aumentar os efeitos de outros fármacos

propriedades

hipertensoras

(por

exemplo,

guanetidina,

metildopa,

vasodilatadores, IECA, ARA, bloqueadores beta, bloqueadores dos canais do cálcio,

inibidores diretos da renina).

Aminas pressoras (ex. noradrenalina, adrenalina)

Possível redução de resposta às aminas pressoras. O significado clínico deste efeito é

incerto e não o suficiente para impedir a sua utilização.

APROVADO EM

28-02-2019

INFARMED

Medicamentos

anti-inflamatórios

não-esteroides

(AINEs),

incluindo

inibidores

seletivos da COX-2, ácido acetilsalicílico (>3 g/dia), e AINEs não seletivos

Os AINEs podem atenuar o efeito anti-hipertensivo tanto dos antagonistas da

angiotensina II como da hidroclorotiazida quando administrados simultaneamente.

Adicionalmente, a utilização concomitante de Valsartan + Hidroclorotiazida Mylan e

AINEs pode levar a um aumento da degradação da função renal e a um aumento no

potássio sérico. Assim, recomenda-se a monitorização da função renal no início do

tratamento, bem como a hidratação adequada do doente.

Interações relacionadas com valsartan

Duplo bloqueio do sistema renina-angiotensina-aldosterona (SRAA) com IECAs, ARAs

ou alicesreno

Os dados de ensaios clínicos têm demonstrado que o duplo bloqueio do sistema

renina-angiotensina-aldosterona (SRAA) através do uso combinado de inibidores da

ECA, antagonistas dos recetores da angiotensina II ou aliscireno está associado a

maior

frequência

acontecimentos

adversos,

tais

como

hipotensão,

hipercaliemia e função renal diminuída (incluindo insuficiência renal aguda) em

comparação com o uso de um único fármaco com ação no SRAA (ver secções 4.3,

4.4 e 5.1).

Utilização concomitante não recomendada

Diuréticos poupadores de potássio, suplementos de potássio, substitutos de sal

contendo potássio e outras substâncias que podem aumentar os níveis de potássio

Se se considerar necessário utilizar um medicamento que afeta os níveis de potássio

em associação com valsartan, aconselha-se a monitorização dos níveis de potássio.

Transportadores

Dados in vitro indicam que o valsartan é um substrato do transportador da captação

hepática

OATP1B1/OATP1B3

transportador

efluxo

hepático

MRP2.

relevância clínica desta descoberta é desconhecida. A coadministração de inibidores

do transportador da captação (por ex., rifampicina, ciclosporina) ou do transportador

de efluxo (por ex., ritonavir) pode aumentar a exposição sistémica ao valsartan.

Deve tomar-se precaução quando se inicia ou se conclui tratamento concomitante

com estes fármacos.

Sem interações

Nos estudos de interações medicamentosas com valsartan, não foram observadas

quaisquer interações clinicamente significativas com valsartan ou com qualquer um

fármacos

seguintes:

cimetidina,

varfarina,

furosemida,

digoxina,

atenolol,

indometacina,

hidroclorotiazida,

amlodipina,

glibenclamida.

Digoxina

indometacina podem interagir com o componente hidroclorotiazida de Valsartan +

Hidroclorotiazida Mylan (ver interações relacionadas com hidroclorotiazida).

Interações relacionadas com hidroclorotiazida

Utilização concomitante que requer precaução

Medicamentos que afetam o nível sérico de potássio

APROVADO EM

28-02-2019

INFARMED

O efeito hipocaliémico da hidroclorotiazida pode ser aumentado pela administração

concomitante

diuréticos

caliuréticos,

corticosteroides,

laxantes,

ACTH,

anfotericina, carbenoxolona, penicilina G, ácido salicílico e derivados)

estes

medicamentos

forem

prescritos

juntamente

associação

hidroclorotiazida-valsartan, é aconselhável a monitorização dos níveis plasmáticos de

potássio. (ver secção 4.4).

Medicamentos que podem induzir “Torsade de pointes”

Antiarrítmicos de classe Ia (por ex., quinidina, hidroquinidina, disopiramida)

Antiarrítmicos de classe III (por ex., amiodarona, sotalol, dofetilida, ibutilida)

Alguns

antipsicóticos

(por

ex.,

tioridazina,

clorpromazina,

levomepromazina,

trifluoperazina, ciamemazina, sulpirida, sultoprida, amissulprida, tiaprida, pimozida,

haloperidol, droperidol)

Outros

(por

ex.,

bepridilo,

cisaprida,

difemanil,

eritromicina

i.v.,

halofantrina,

cetanserina, mizolastina, pentamidina, esparfloxacina, terfenadina, vincamina i.v.)

Devido ao risco de hipocaliemia, a hidroclorotiazida deve ser administrada com

precaução quando associada a medicamentos indutores de “torsade de pointes”, em

particular antiarrítmicos de Classe Ia e Classe III e alguns antipsicóticos..

Medicamentos que afetam o nível sérico de sódio

O efeito hiponatrémico de diuréticos pode ser intensificado pela administração

concomitante de fármacos como antidepressivos, antipsicóticos, antiepiléticos, etc.

Recomenda-se precaução na administração de longo prazo destes fármacos.

Glicosidos digitálicos

Podem ocorrer, como efeitos adversos, hipocaliemia ou hipomagnesemia induzidas

pelas tiazidas, favorecendo o aparecimento de arritmias cardíacas induzidas pelos

digitálicos.

Sais de cálcio e vitamina D

A administração de diuréticos tiazídicos, incluindo a hidroclorotiazida, com vitamina

D ou com sais de cálcio pode potenciar o aumento do cálcio sérico. A utilização

concomitante de diuréticos do tipo tiazídicos com sais de cálcio pode causar

hipercalcemia

doentes

predispostos

para

hipercalcemia

(por

ex.,

hiperparatireoidismo, doença maligna ou situações mediadas pela vitamina D) ao

aumentar a reabsorção tubular do cálcio.

Fármacos antidiabéticos (fármacos orais e insulina)

As tiazidas podem alterar a a tolerância à glicose. Pode ser necessário ajuste

posológico do medicamento antidiabético.

A metformina deve ser utilizada com precaução devido ao risco de acidose láctica

induzida

possível

insuficiência

renal

funcional

relacionada

hidroclorotiazida.

Bloqueadores beta e diazóxido

O uso concomitante de diuréticos tiazídicos, incluindo a hidroclorotiazida, com

bloqueadores beta pode aumentar o risco de hiperglicemia. Os diuréticos tiazídicos,

incluindo a hidroclorotiazida, podem aumentar o efeito hiperglicémico do diazóxido.

APROVADO EM

28-02-2019

INFARMED

Medicamentos

usados

tratamento

gota

(probenecida,

sulfinpirazona

alopurinol)

Pode ser necessário o ajuste posológico das medicações uricosúricas uma vez que a

hidroclorotiazida pode elevar o nível de ácido úrico sérico. Pode ser necessário o

aumento

posologia

probenecida

sulfinpirazona.

administração

concomitante de diuréticos tiazídicos, incluindo a hidroclorotiazida, pode aumentar a

incidência de reações de hipersensibilidade ao alopurinol.

Fármacos anticolinérgicos (por ex., atropina, biperideno) e outros medicamentos que

afetam a mobilidade gástrica

biodisponibilidade

diuréticos

tipo

tiazídico

pode

aumentada

fármacos anticolinérgicos, aparentemente devido a uma redução da motilidade

gastrointestinal e da taxa de esvaziamento gástrico. Por outro lado, prevê-se que os

medicamentos

procinéticos,

tais

como

cisaprida

possam

diminuir

biodisponibilidade de diuréticos tiazídicos.

Amantadina

As tiazidas,

incluindo

a hidroclorotiazida,

podem

aumentar

o risco

efeitos

adversos causados pela amantadina.

Resinas permutadoras de iões

A absorção dos diuréticos tiazídicos, incluindo a hidroclorotiazida, é diminuída pela

colestiramina ou pelo colestipol. Tal pode resultar em efeitos sub-terapêuticos dos

diuréticos tiazídicos. Contudo, escalonar a dose de hidroclorotiazida e da resina de

modo a que a hidroclorotiazida seja administrada pelo menos 4 h antes ou 4-6h após

a administração das resinas pode potencialmente minimizar a interação.

Fármacos citotóxicos (por ex., ciclofosfamida, metotrexato)

As tiazidas, incluindo

a hidroclorotiazida,

podem

reduzir

excreção

renal de

fármacos citotóxicos e potenciar os seus efeitos mielossupressores.

Relaxantes musculares esqueléticos não-despolarizantes (por ex., tubocurarina)

tiazidas,

incluindo

hidroclorotiazida,

potenciam

ação

relaxantes

musculares esqueléticos, como os derivados do curare.

Ciclosporina

O tratamento concomitante com ciclosporina pode aumentar o risco de hiperuricemia

e de complicações tipo gota.

Álcool, barbituratos ou narcóticos

A administração concomitante de diuréticos tiazídicos com substâncias que também

têm um efeito anti-hipertensor (por ex., através da redução da atividade do sistema

nervoso central simpático ou por atividade decvasodilatação direta) pode potenciar

hipotensão ortostática.

Metildopa

Foram notificados casos pontuais de anemia hemolítica em doentes que receberam

tratamento concomitante de metildopa e hidroclorotiazida.

Carbamazepina

















Voltar para o conteúdo

Preços Válidos



Nome do Medicamento: Número de Registo:


Preços PVP

Preço (PVP)

Data de Início

Sem preços válidos.






Preços Notificados

Data de Início

Data de Fim

Sem preços válidos.






Preços Válidos

Data de Início

Data de Fim

Sem preços válidos.






Guia e condições de utilização

PTEN

Pesquisa Avançada Detalhes do Medicamento





Detalhes do Medicamento: Valsartan + Hidroclorotiazida Farmoz

Medicamento sujeito a monitorização adicional

Resumo das Características do Medicamento

Folheto Informativo

Medidas adicionais de Minimização do Risco



Informação Geral





Substância Ativa/DCI: Valsartan + Hidroclorotiazida Forma Farmacêutica: Comprimido revestido por película Nome do Medicamento: Valsartan + Hidroclorotiazida Farmoz Dosagem: 160 mg + 12.5 mg Titular de AIM: Farmoz - Sociedade Técnico Medicinal, S.A. Genérico: Sim Via(s) de Administração:


Via oral



Grupo de Produto:


Genérico



Número de Processo: 11/H/0235/002 Margem Terapêutica Estreita: Não

Estado





AIM: Autorizado Data: 20/03/2012

Classificação





Classificação Quanto à Dispensa:


MSRM

Medicamento sujeito a receita médica



Classificação Estupefaciente: Não se aplica Classificação ATC:


C09DA03 - valsartan and diuretics



Classificação Farmacoterapêutica:


3.4.1.1 - Tiazidas e análogos

3.4.2.2 - Antagonistas dos receptores da angiotensina



Duração do Tratamento: Longa Duração

Composição Qualitativa e Quantitativa em Substâncias Ativas





Valsartan - 160 mg

Valsartan - 160 mg

Hidroclorotiazida - 12.5 mg

Hidroclorotiazida - 12.5 mg



Apresentações



3 apresentações

Preços

PVP:

3,65 €

P. Ref.:

2,28 €

P. Max.:

3,65 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação:

fechada

Prazo de Validade:

4 Ano(s)

Temperatura:

inferior a 30°C

Preços

PVP:

9,30 €

P. Ref.:

6,61 €

P. Max.:

12,02 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação:

fechada

Prazo de Validade:

4 Ano(s)

Temperatura:

inferior a 30°C

Preços

PVP:

8,10 €

P. Max.:

8,10 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação:

fechada

Prazo de Validade:

4 Ano(s)

Temperatura:

inferior a 30°C

Previous Next



Blister 14 unidade(s) Comercializado

Número de Registo: 5573324 CNPEM: 50038389 CHNM: 10064617 Dispositivo Segurança: Sim Comparticipação: 69% Grupo Homogéneo: Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [1-20] unidades

Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [1-20] unidades

Preços PVP: 3,65 € P. Ref.: 2,28 € P. Max.: 3,65 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação: fechada Prazo de Validade: 4 Ano(s) Temperatura: inferior a 30°C



Blister 56 unidade(s) Comercializado

Número de Registo: 5446745 CNPEM: 50038400 CHNM: 10064617 Dispositivo Segurança: Sim Comparticipação: 69% Grupo Homogéneo: Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [21-60] unidades

Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [21-60] unidades

Preços PVP: 9,30 € P. Ref.: 6,61 € P. Max.: 12,02 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação: fechada Prazo de Validade: 4 Ano(s) Temperatura: inferior a 30°C



Blister 28 unidade(s) Não Comercializado

Número de Registo: 5446737 CNPEM: 50038397 CHNM: 10064617 Dispositivo Segurança: Sim Comparticipação: 0% Grupo Homogéneo: N/A

Preços PVP: 8,10 € P. Max.: 8,10 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação: fechada Prazo de Validade: 4 Ano(s) Temperatura: inferior a 30°C

Preços

PVP:

3,65 €

P. Ref.:

2,28 €

P. Max.:

3,65 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação:

fechada

Prazo de Validade:

4 Ano(s)

Temperatura:

inferior a 30°C

Preços

PVP:

9,30 €

P. Ref.:

6,61 €

P. Max.:

12,02 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação:

fechada

Prazo de Validade:

4 Ano(s)

Temperatura:

inferior a 30°C

Preços

PVP:

8,10 €

P. Max.:

8,10 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação:

fechada

Prazo de Validade:

4 Ano(s)

Temperatura:

inferior a 30°C

Previous Next



Blister 14 unidade(s) Comercializado

Número de Registo: 5573324 CNPEM: 50038389 CHNM: 10064617 Dispositivo Segurança: Sim Comparticipação: 69% Grupo Homogéneo: Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [1-20] unidades

Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [1-20] unidades

Preços PVP: 3,65 € P. Ref.: 2,28 € P. Max.: 3,65 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação: fechada Prazo de Validade: 4 Ano(s) Temperatura: inferior a 30°C



Blister 56 unidade(s) Comercializado

Número de Registo: 5446745 CNPEM: 50038400 CHNM: 10064617 Dispositivo Segurança: Sim Comparticipação: 69% Grupo Homogéneo: Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [21-60] unidades

Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [21-60] unidades

Preços PVP: 9,30 € P. Ref.: 6,61 € P. Max.: 12,02 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação: fechada Prazo de Validade: 4 Ano(s) Temperatura: inferior a 30°C



Blister 28 unidade(s) Não Comercializado

Número de Registo: 5446737 CNPEM: 50038397 CHNM: 10064617 Dispositivo Segurança: Sim Comparticipação: 0% Grupo Homogéneo: N/A

Preços PVP: 8,10 € P. Max.: 8,10 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação: fechada Prazo de Validade: 4 Ano(s) Temperatura: inferior a 30°C

Preços

PVP:

3,65 €

P. Ref.:

2,28 €

P. Max.:

3,65 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação:

fechada

Prazo de Validade:

4 Ano(s)

Temperatura:

inferior a 30°C

Preços

PVP:

9,30 €

P. Ref.:

6,61 €

P. Max.:

12,02 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação:

fechada

Prazo de Validade:

4 Ano(s)

Temperatura:

inferior a 30°C

Preços

PVP:

8,10 €

P. Max.:

8,10 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação:

fechada

Prazo de Validade:

4 Ano(s)

Temperatura:

inferior a 30°C

Previous Next



Blister 14 unidade(s) Comercializado

Número de Registo: 5573324 CNPEM: 50038389 CHNM: 10064617 Dispositivo Segurança: Sim Comparticipação: 69% Grupo Homogéneo: Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [1-20] unidades

Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [1-20] unidades

Preços PVP: 3,65 € P. Ref.: 2,28 € P. Max.: 3,65 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação: fechada Prazo de Validade: 4 Ano(s) Temperatura: inferior a 30°C



Blister 56 unidade(s) Comercializado

Número de Registo: 5446745 CNPEM: 50038400 CHNM: 10064617 Dispositivo Segurança: Sim Comparticipação: 69% Grupo Homogéneo: Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [21-60] unidades

Valsartan + Hidroclorotiazida | A101 | Oral | 160 mg + 12.5 mg | [21-60] unidades

Preços PVP: 9,30 € P. Ref.: 6,61 € P. Max.: 12,02 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação: fechada Prazo de Validade: 4 Ano(s) Temperatura: inferior a 30°C



Blister 28 unidade(s) Não Comercializado

Número de Registo: 5446737 CNPEM: 50038397 CHNM: 10064617 Dispositivo Segurança: Sim Comparticipação: 0% Grupo Homogéneo: N/A

Preços PVP: 8,10 € P. Max.: 8,10 €

Preços Válidos: ui-button

Condições de Armazenamento

Tipo de Apresentação: fechada Prazo de Validade: 4 Ano(s) Temperatura: inferior a 30°C



Documentos para Profissionais de Saúde


Resumo das Características do Medicamento (RCM)


Relatório Público de Avaliação (PAR)


Medidas adicionais de Minimização do Risco (MMR)



Documentos para o Público


Folheto Informativo (FI)





A Infomed é a base de dados nacional de medicamentos de uso humano e destina-se a todos os cidadãos.
Para que esta base de dados seja para todos, é fundamental a sua constante evolução. Envie-nos as suas sugestões.

A Infomed é a base de dados nacional de medicamentos de uso humano e destina-se a todos os cidadãos.
Para que esta base de dados seja para todos, é fundamental a sua constante evolução. Envie-nos as suas sugestões.



Produtos Similares

Pesquisar alertas relacionados a este produto

Ver histórico de documentos

Compartilhe esta informação