Escitalopram Apotex 5 mg Comprimido orodispersível

Portugal - português - INFARMED (Autoridade Nacional do Medicamento e Produtos de Saúde)

Compre agora

Ingredientes ativos:
Escitalopram
Disponível em:
Apotex Europe, B.V.
Código ATC:
N06AB10
DCI (Denominação Comum Internacional):
Escitalopram
Dosagem:
5 mg
Forma farmacêutica:
Comprimido orodispersível
Composição:
Escitalopram, oxalato 6.3875 mg
Via de administração:
Via oral
Classe:
2.9.3 - Antidepressores
Tipo de prescrição:
MSRM Medicamento sujeito a receita médica
Grupo terapêutico:
Genérico
Área terapêutica:
escitalopram
Indicações terapêuticas:
Duração do Tratamento: Longa Duração
Resumo do produto:
Blister 12 unidade(s) Não Comercializado Número de Registo: 5627302 CNPEM: 50150162 CHNM: 10099881 Grupo Homogéneo: N/A; Blister 14 unidade(s) Não Comercializado Número de Registo: 5627278 CNPEM: 50150162 CHNM: 10099881 Grupo Homogéneo: N/A; Blister 20 unidade(s) Não Comercializado Número de Registo: 5627310 CNPEM: 50150162 CHNM: 10099881 Grupo Homogéneo: N/A; Blister 28 unidade(s) Não Comercializado Número de Registo: 5627328 CNPEM: 50139479 CHNM: 10099881 Grupo Homogéneo: N/A; Blister 50 unidade(s) Não Comercializado Número de Registo: 5627336 CNPEM: 50150170 CHNM: 10099881 Grupo Homogéneo: N/A; Blister 56 unidade(s) Não Comercializado Número de Registo: 5627344 CNPEM: 50150170 CHNM: 10099881 Grupo Homogéneo: N/A; Blister 60 unidade(s) Não Comercializado Número de Registo: 5627351 CNPEM: 50150170 CHNM: 10099881 Grupo Homogéneo: N/A; Blister 98 unidade(s) Não Comercializado Número de Registo: 5627369 CNPEM: 50150189 CHNM: 10099881 Grupo Homogéneo: N/A; Blister 100 unidade(s) Não Comercializado Número de Registo: 5627377 CNPEM: 50150189 CHNM: 10099881 Grupo Homogéneo: N/A; Blister 200 unidade(s) Não Comercializado Número de Registo: 5627401 CNPEM: 50150197 CHNM: 10099881 Grupo Homogéneo: N/A
Status de autorização:
Autorizado
Número de autorização:
PT/H/0897/001/DC
Data de autorização:
2014-11-05

Leia o documento completo

APROVADO EM

21-01-2021

INFARMED

Folheto informativo: Informação para o utilizador

Escitalopram Apotex 5 mg comprimidos orodispersíveis

Escitalopram Apotex 10 mg comprimidos orodispersíveis

Escitalopram Apotex 15 mg comprimidos orodispersíveis

Escitalopram Apotex 20 mg comprimidos orodispersíveis

escitalopram

Leia com atenção todo este folheto antes de começar a tomar este medicamento pois

contém informação importante para si.

&RQVHUYHHVWHIROKHWR3RGHWHUQHFHVVLGDGHGHROHUQRYDPHQWH

&DVRDLQGDWHQKDG¼YLGDVIDOHFRPRVHXP«GLFRRXIDUPDF¬XWLFR

(VWHPHGLFDPHQWRIRLUHFHLWDGRDSHQDVSDUDVL1¥RGHYHG£ORDRXWURV2

PHGLFDPHQWRSRGHVHUOKHVSUHMXGLFLDOPHVPRTXHDSUHVHQWHPRVPHVPRV

VLQDLVGHGRHQ©D

6HWLYHUTXDLVTXHUHIHLWRVVHFXQG£ULRVLQFOXLQGRSRVV¯YHLVHIHLWRVVHFXQG£ULRV

Q¥RLQGLFDGRVQHVWHIROKHWRIDOHFRPRVHXP«GLFRRXIDUPDF¬XWLFR9HUVHF©¥R

O que contém este folheto:

O que é Escitalopram Apotex e para que é utilizado

O que precisa de saber antes de tomar Escitalopram Apotex

Como tomar Escitalopram Apotex

Efeitos secundários possíveis

Como conservar Escitalopram Apotex

Conteúdo da embalagem e outras informações

O que é Escitalopram Apotex e para que é utilizado

Escitalopram Apotex contém a substância ativa escitalopram e pertence a um grupo

de antidepressores conhecidos como inibidores seletivos da recaptação de serotonina

(ISRS).

Estes

medicamentos

atuam

sistema

serotoninérgico

cérebro

aumentando o nível de serotonina. As perturbações no sistema serotoninérgico são

consideradas um fator importante no desenvolvimento da depressão e doenças

relacionadas.

Escitalopram Apotex contém escitalopram e é utilizado para o tratamento da

depressão (episódios depressivos major) e perturbações de ansiedade (tais como

perturbações de pânico com ou sem agorafobia, perturbação de ansiedade social,

perturbação da ansiedade generalizada e perturbação obsessiva-compulsiva).

APROVADO EM

21-01-2021

INFARMED

Pode demorar algumas semanas até que comece a sentir-se melhor. Continue a

tomar Escitalopram Apotex, mesmo que demore algum tempo até sentir qualquer

melhoria na sua condição. Consulte o médico se não se sentir melhor ou se se sentir

pior.

O que precisa de saber antes de tomar Escitalopram Apotex

Não tome Escitalopram Apotex:

VHWHPDOHUJLD KLSHUVHQVLELOLGDGH DRHVFLWDORSUDPRXDTXDOTXHURXWUR

FRPSRQHQWHGHVWHPHGLFDPHQWR LQGLFDGRVQDVHF©¥R 

VHWRPDRXWURVPHGLFDPHQWRVTXHSHUWHQFHPDXPJUXSRFKDPDGRLQLELGRUHV

GD0$2LQFOXLQGRDVHOHJLOLQD XWLOL]DGDQRWUDWDPHQWRGDGRHQ©DGH3DUNLQVRQ 

PRFOREHPLGD XWLOL]DGDQRWUDWDPHQWRGDGHSUHVV¥R HOLQH]ROLGD XP

DQWLELµWLFR 

6HQDVFHXFRPXPDDQRPDOLDGRULWPRFDUG¯DFRRXM£WHYHXPHSLVµGLRGHULWPR

FDUG¯DFRDQRUPDO SHUFHW¯YHOQRHOHWURFDUGLRJUDPDXPH[DPHTXHDYDOLDR

IXQFLRQDPHQWRGRFRUD©¥R 

6HWRPDPHGLFDPHQWRVSDUDSUREOHPDVGRULWPRFDUG¯DFRRXTXHSRVVDPDIHWDU

RULWPRFDUG¯DFR YHUVHF©¥Rಯ2XWURVPHGLFDPHQWRVH(VFLWDORSUDP$SRWH[ರ 

Advertências e precauções

Fale com o seu médico, ou farmacêutico antes de tomar Escitalopram Apotex.

Informe o seu médico se tem qualquer outra condição ou doença, uma vez que o seu

médico pode precisar de ter isso em consideração. Em particular, informe o seu

médico:

VHWHPHSLOHSVLD2WUDWDPHQWRFRP(VFLWDORSUDP$SRWH[GHYHVHULQWHUURPSLGR

VHRFRUUHUHPFRQYXOV·HVSHODSULPHLUDYH]RXVHKRXYHUXPDXPHQWRGD

IUHTX¬QFLDGHFRQYXOV·HV YHUWDPE«PDVHF©¥Rಯ(IHLWRVVHFXQG£ULRV

SRVV¯YHLV 

VHWHPSUREOHPDVDQ¯YHOGDIXQ©¥RGRI¯JDGRRXGRULP2VHXP«GLFRSRGH

QHFHVVLWDUGHDMXVWDUDVXDGRVH

VHWHPGLDEHWHV2WUDWDPHQWRFRP(VFLWDORSUDP$SRWH[SRGHDOWHUDURFRQWUROR

JOLF«PLFR$GRVHGHLQVXOLQDHRXKLSRJOLFHPLDQWHVRUDLVSRGHQHFHVVLWDUGHVHU

DMXVWDGD

VHWHPXPQ¯YHOUHGX]LGRGHVµGLRQRVDQJXH

VHWHPWHQG¬QFLDSDUDGHVHQYROYHUIDFLOPHQWHKHPRUUDJLDVRXQµGRDVQHJUDVRX

VHHVWLYHUJU£YLGD YHUಯ*UDYLGH]DPDPHQWD©¥RHIHUWLOLGDGHರ 

VHHVW£DUHFHEHUWUDWDPHQWRHOHWURFRQYXOVLYR

APROVADO EM

21-01-2021

INFARMED

VHWHPXPDGRHQ©DFDUG¯DFDFRURQ£ULD

VHVRIUHRXM£VRIUHXGHSUREOHPDVGRFRUD©¥RRXWHYHUHFHQWHPHQWHXPDWDTXH

FDUG¯DFR

VHWHPXPULWPRFDUG¯DFROHQWRHPUHSRXVRHRXWHPFRQVFL¬QFLDTXHSRGHWHU

Q¯YHLVEDL[RVGHVDLVPLQHUDLVQRVDQJXHGHYLGRDVLWXD©·HVGHGLDUUHLDLQWHQVD

YµPLWRVRXXWLOL]D©¥RGHGLXU«WLFRV PHGLFDPHQWRVSDUDDWHQV¥RDOWDTXHID]HP

XULQDUPDLV 

VHVHQWHXPULWPRU£SLGRRXLUUHJXODUGRFRUD©¥RVHQVD©¥RGHGHVPDLRFRODSVR

RXWRQWXUDVDRS¶UVHHPS«RXOHYDQWDUVHRTXHSRGHLQGLFDUDOWHUD©·HVGR

ULWPRFDUG¯DFR

VHWHPRXWHYHDQWHULRUPHQWHSUREOHPDVQRVROKRVSRUH[HPSORFHUWRVWLSRVGH

JODXFRPD DXPHQWRGHSUHVV¥RQRROKR 

Nota

Alguns doentes com doença maníaco-depressiva podem entrar numa fase maníaca.

Esta

caracterizada

invulgar

rápida

alteração

ideias,

alegria

inapropriada e excessiva atividade física. Se se sentir assim, contate o seu médico.

Sintomas como inquietação ou dificuldade em se sentar ou permanecer sentado

podem também ocorrer durante as primeiras semanas de tratamento. Informe o seu

médico imediatamente se sentir estes sintomas.

Ideação suicida e agravamento da depressão ou perturbação de ansiedade

Se sofrer de depressão e/ou perturbações de ansiedade, pode ter, às vezes,

pensamentos de autoagressão ou de suicídio. Estes pensamentos podem aumentar

início

tratanmento

antidepressivos,

todos

estes

medicamentos

necessitam

tempo

para

atuarem.

Normalmente,

efeitos

terapêuticos demoram cerca de duas semanas para fazer efeito, mas por vezes,

pode demorar mais tempo.

Poderá estar mais predisposto a ter este tipo de pensamentos:

VHWHPDQWHFHGHQWHVGHSHQVDPHQWRVVXLFLGDVRXGHDXWRDJUHVV¥R

VHIRUXPMRYHPDGXOWR$LQIRUPD©¥RSURYHQLHQWHGHHVWXGRVFO¯QLFRVUHYHORX

XPPDLRUULVFRGHFRPSRUWDPHQWRVXLFLGDHPDGXOWRVFRPLGDGHLQIHULRUD

DQRVFRPSUREOHPDVSVLTXL£WULFRVWUDWDGRVFRPDQWLGHSUHVVLYRV

Se em qualquer momento vier a ter pensamentos no sentido de autoagressão ou

suicídio, deverá contactar o seu médico ou dirigir-se imediatamente ao hospital.

Pode ser útil para si comunicar a um familiar ou amigo próximo que se sente

deprimido ou sofre de uma perturbação de ansiedade, e dar-lhes este folheto a ler.

APROVADO EM

21-01-2021

INFARMED

Pode pedir-lhes para lhe dizerem se acham que a depressão ou ansiedade está a

piorar ou se estão preocupados com as alterações no seu comportamento.

Crianças e adolescentes

Escitalopram Apotex não deve normalmente ser utilizado em crianças e adolescentes

com idade inferior a 18 anos. Importa igualmente salientar que os doentes com

idade inferior a 18 anos correm maior risco de sofrerem efeitos secundários tais

como

tentativa

suicídio,

ideação

suicida

hostilidade

(predominantemente

agressividade, comportamento de oposição e cólera) quando tomam medicamentos

desta classe. Apesar disso, o médico poderá prescrever Escitalopram Apotex para

doentes com idade inferior a 18 anos quando decidir que isso é no melhor interesse

do doente. Se o seu médico prescreveu Escitalopram Apotex para um doente com

idade inferior a 18 anos e gostaria de discutir esta questão, queira voltar a contatá-

lo. Deverá informar o seu médico se algum dos sintomas acima mencionados se

desenvolver ou piorar quando doentes com idade inferior a 18 anos, estejam a tomar

Escitalopram Apotex. Assinala-se igualmente que não foram ainda demonstrados os

efeitos de segurança a longo prazo no que respeita a crescimento, à maturação e ao

desenvolvimento cognitivo e comportamental de Escitalopram Apotex, nesta faixa

etária.

Outros medicamentos e Escitalopram Apotex

Informe o seu médico ou farmacêutico se estiver a tomar, ou tiver tomado

recentemente, ou se vier a tomar outros medicamentos.

Informe o seu médico se estiver a tomar algum dos seguintes medicamentos:

,QLELGRUHVQ¥RVHOHWLYRVGDPRQRDPLQDR[LGDVH ,0$2 FRQWHQGRIHQHO]LQD

LSURQLD]LGDLVRFDUER[D]LGDQLDODPLGDHWUDQLOFLSURPLQDFRPRVXEVW¤QFLDV

DWLYDV6HWRPRXDOJXPGHVWHVPHGLFDPHQWRVWHU£GHHVSHUDUGLDVDQWHVGH

LQLFLDUDWRPDGH(VFLWDORSUDP$SRWH[$SµVDSDUDJHPGH(VFLWDORSUDP$SRWH[

GHYHHVSHUDUGLDVDQWHVGHWRPDUTXDOTXHUXPGHVWHVPHGLFDPHQWRV

,QLELGRUHVUHYHUV¯YHLVVHOHWLYRVGD0$2$FRQWHQGRPRFOREHPLGD XWLOL]DGD

SDUDWUDWDUDGHSUHVV¥R 

,QLELGRUHVLUUHYHUV¯YHLVGD0$2%FRQWHQGRVHOHJLOLQD XWLOL]DGDSDUDWUDWDUD

GRHQ©DGH3DUNLQVRQ (VWHVDXPHQWDPRULVFRGHHIHLWRVVHFXQG£ULRV

DQWLELµWLFROLQH]ROLGD

/¯WLR XWLOL]DGRQRWUDWDPHQWRGDSHUWXUED©¥RPDQ¯DFRGHSUHVVLYD HWULSWRIDQR

,PLSUDPLQDHGHVLSUDPLQD DPEDVXWLOL]DGDVQRWUDWDPHQWRGDGHSUHVV¥R 

6XPDWULSWDQRHPHGLFDPHQWRVVLPLODUHV XWLOL]DGRVQRWUDWDPHQWRGDHQ[DTXHFD 

HWUDPDGRO XWLOL]DGRQDGRULQWHQVD (VWHVDXPHQWDPRULVFRGHHIHLWRV

VHFXQG£ULRV

APROVADO EM

21-01-2021

INFARMED

Cimetidina, lansoprazol e omeprazol (utilizados no tratamentos das úlceras do

estômago), fluvoxamina (antidepressivo) e ticlopidina (usada para reduzir o risco de

trombose). Estes podem aumentar os níveis sanguíneos de escitalopram;

+LSHULF¥R +\SHULFXPSHUIRUDWXP ದXPPHGLFDPHQWR¢EDVHGHSODQWDVXWLOL]DGR

SDUDDGHSUHVV¥R

ƒFLGRDFHWLOVDOLF¯OLFRHPHGLFDPHQWRVDQWLLQIODPDWµULRVQ¥RHVWHURLGHV

PHGLFDPHQWRVXWLOL]DGRVSDUDRDO¯YLRGDGRUHSDUDGLOXLURVDQJXHFKDPDGRV

DQWLFRDJXODQWHV (VWHVSRGHPDXPHQWDUDWHQG¬QFLDSDUDKHPRUUDJLD

9DUIDULQDGLSLULGDPROHIHQSURFXPRQ PHGLFDPHQWRVXWLOL]DGRVSDUDGLOXLUR

VDQJXHRVFKDPDGRVDQWLFRDJXODQWHV 2VHXP«GLFRLU£SURYDYHOPHQWH

YHULILFDURWHPSRGHFRDJXOD©¥RGRVHXVDQJXHDRLQLFLDURXSDUDURWUDWDPHQWR

FRP(VFLWDORSUDP$SRWH[GHPRGRDFRQILUPDUVHDVXDGRVHGHDQWLFRDJXODQWH

DLQGD«DGHTXDGD

0HIORTXLQD XWLOL]DGDQRWUDWDPHQWRGDPDO£ULD EXSURSLRQD XWLOL]DGRQR

WUDWDPHQWRGDGHSUHVV¥R HWUDPDGRO XWLOL]DGRQRWUDWDPHQWRGDGRULQWHQVD 

GHYLGRDXPULVFRSRVV¯YHOGHGLPLQXLUROLPLDUGHFRQYXOV·HV

1HXURO«WLFRV PHGLFDPHQWRVSDUDWUDWDUHVTXL]RIUHQLDSVLFRVH H

DQWLGHSUHVVLYRV DQWLGHSUHVVLYRVWULF¯FOLFRVH,656 GHYLGRDXPSRVV¯YHOULVFR

GHGLPLQXLUROLPLDUGHFRQYXOV·HV

)OHFDLQLGDSURSDIHQRQDHPHWRSURORO XWLOL]DGRVHPGRHQ©DVFDUGLRYDVFXODUHV 

FORPLSUDPLQDHQRUWULSWLOLQD DQWLGHSUHVVLYRV HULVSHULGRQDWLRULGD]LQDH

KDORSHULGRO DQWLSVLFµWLFRV 3RGHVHUQHFHVV£ULRDMXVWDUDGRVHGR(VFLWDORSUDP

$SRWH[

2VPHGLFDPHQWRVTXHUHGX]HPRVQ¯YHLVGHSRW£VVLRRXPDJQ«VLRQRVDQJXH

XPDYH]TXHHVWDVFRQGL©·HVDXPHQWDPRULVFRGHXPDSHUWXUED©¥RGRULWPR

FDUG¯DFRSRWHQFLDOPHQWHIDWDO

Não tome Escitalopram Apotex se está a tomar medicamentos para problemas de

ritmo cardíaco ou quaisquer outros medicamentos que possam afetar o ritmo

cardíaco, como medicamentos antiarrítmicos de Classe IA e III, antipsicóticos (por

exemplo, derivados da fenotiazina, pimozida, haloperidol), antidepressivos tricíclicos,

certos

agentes

antimicrobianos

(por

exemplo,

esparfloxacina,

moxifloxacina,

eritromicina IV, pentamidina, antimaláricos particularmente halofantrina) certos anti-

histamínicos (astemizol, mizolastina). Se tiver alguma dúvida fale com o seu médico.

Escitalopram Apotex com alimentos, bebidas e álcool

APROVADO EM

21-01-2021

INFARMED

Escitalopram Apotex pode ser tomado com ou sem alimentos (ver secção 3 “Como

tomar Escitalopram Apotex”).

Tal como com muitos medicamentos, associar Escitalopram Apotex com álcool não é

aconselhável, apesar de não se esperar uma interação de Escitalopram Apotex com o

álcool.

Gravidez, amamentação e fertilidade

Se está grávida ou a amamentar, se pensa estar grávida ou planeia engravidar,

consulte o seu médico ou farmacêutico antes de tomar este medicamento. Não tome

Escitalopram Apotex se está grávida ou a amamentar, a menos que tenha discutido

os riscos e benefícios envolvidos com o seu médico.

Se tomou Escitalopram Apotex durante os últimos 3 meses de gravidez deve ter em

atenção que podem ocorrer os efeitos seguintes no seu bebé recém-nascido:

dificuldades

respirar,

pele

azulada,

convulsões,

alterações

temperatura

corporal, dificuldades de alimentação, vómitos, baixo nível de açúcar no sangue,

músculos rígidos ou flácidos, reflexos intensos, tremores, agitação, irritabilidade,

letargia, choro constante, sonolência e dificuldades em dormir. Se o seu bebé recém-

nascido apresentar algum destes sintomas, contate o seu médico imediatamente.

Certifique-se que o seu médico e/ou o pessoal de enfermagem sabem que está a

tomar Escitalopram Apotex. Quando tomados durante a gravidez, especialmente nos

últimos 3 meses de gravidez, os medicamentos como Escitalopram Apotex podem

aumentar o risco de um problema grave nos bebés, chamado hipertensão pulmonar

persistente no recém-nascido (HPPRN), que faz com que o bebé respire mais

rapidamente e que pareça azulado. Estes sintomas começam habitualmente durante

as primeiras 24 horas após o nascimento. Se isto acontecer ao seu bebé deverá

contatar o seu médico e/ou o pessoal de enfermagem, imediatamente.

Se for usado durante a gravidez Escitalopram Apotex nunca deve ser interrompido

abruptamente.

Se tomar Escitalopram Apotex próximo do final da gravidez pode existir um risco

aumentado de hemorragia vaginal abundante pouco depois do parto, em especial se

tiver

história

doenças

hemorrágicas.

médico

especialista

enfermagem de saúde materna e obstétrica devem ter conhecimento de que está a

tomar Escitalopram Apotex, para que a possam aconselhar.

É esperado que Escitalopram Apotex seja excretado no leite materno.

Há evidências de estudos em animais de que o citalopram, um medicamento

semelhante ao escitalopram, reduz a qualidade do esperma. Teoricamente, esta

situação pode afetar a fertilidade, mas até à data não foi observado o impacto na

fertilidade humana.

Condução de veículos e utilização de máquinas

APROVADO EM

21-01-2021

INFARMED

É aconselhável não conduzir nem utilizar máquinas até que saiba como Escitalopram

Apotex o afeta.

Escitalopram Apotex contém lactose

Se o seu médico lhe disse que sofre de intolerância a alguns açúcares, contacte-o

antes de tomar este medicamento.

Como tomar Escitalopram Apotex

Tome

este

medicamento

exatamente

como

indicado

pelo

médico

farmacêutico. Fale com o seu médico ou farmacêutico se tiver dúvidas.

Escitalopram Apotex comprimidos orodispersíveis são tomados todos os dias como

uma dose diária única. Pode tomar Escitalopram Apotex com ou sem alimentos.

Escitalopram Apotex comprimidos orodispersíveis partem facilmente, portanto devem

ser manuseados com cuidado. Não mexa nos comprimidos com as mãos molhadas

porque os comprimidos podem desfazer-se.

Segure no blister pelas extremidades e separe um compartimento do blister

dos restantes, retirando-o suavemente pelas perfurações.

Retire cuidadosamente a película.

Coloque

comprimido

língua.

comprimido

desintegrar-se-á

rapidamente epode ser engolido sem água.

Adultos

Depressão

A dose recomendada de Escitalopram Apotex é de 10 mg tomada como uma dose

única diária. A dose pode ser aumentada pelo seu médico até um máximo de 20 mg

por dia.

Perturbações de pânico

A dose inicial de Escitalopram Apotex é de 5 mg como dose única diária durante a

primeira semana antes de se aumentar a dose para 10 mg por dia. A dose pode ser

ainda aumentada pelo seu médico até um máximo de 20 mg por dia.

Perturbação de ansiedade social

A dose recomendada habitualmente de Escitalopram Apotex é de 10 mg tomada

como uma dose única diária. O seu médico poderá diminuir a sua dose para 5 mg

por dia ou aumentá-la até um máximo de 20 mg por dia, dependendo de como

responder ao medicamento.

Perturbação da ansiedade generalizada

A dose recomendada habitualmente de Escitalopram Apotex é 10 mg tomada como

dose diária única. A dose pode ser aumentada pelo seu médico até um máximo de

20 mg por dia.

Perturbação obsessiva-compulsiva

A dose habitualmente recomendada de Escitalopram Apotex é 10 mg tomada como

dose única diária. A dose pode ser aumentada pelo seu médico até um máximo de

20 mg por dia.

APROVADO EM

21-01-2021

INFARMED

Doentes idosos (com idade superior a 65 anos)

A dose inicial recomendada de Escitalopram Apotex é 5 mg tomada como dose única

diária. A dose pode ser aumentada pelo seu médico até ao máximo de 10 mg por

dia.

Crianças e adolescentes

Escitalopram Apotex não deve ser administrado a crianças e adolescentes. Para mais

informações,

consulte

secção

“O

precisa

saber

antes

tomar

Escitalopram Apotex”.

Duração do tratamento

Podem decorrer duas semanas até até começar a sentir-se melhor. Continue a tomar

Escitalopram Apotex mesmo se demorar algum tempo a sentir uma melhoria do seu

estado.

Não altere a dose do medicamento sem falar primeiro com o seu médico.

Continue a tomar Escitalopram Apotex enquanto o seu médico assim o recomendar.

Se parar o tratamento demasiado cedo, os sintomas podem voltar. É recomendado

que o tratamento continue durante pelo menos 6 meses após se sentir de novo

melhor.

Se tomar mais Escitalopram Apotex do que deveria

Se tomou mais do que a dose prescrita de Escitalopram Apotex, contate o seu

médico ou as urgências do hospital mais próximo imediatamente. Proceda deste

modo, mesmo que não apresente sinais de desconforto. Alguns dos sinais de

sobredosagem podem ser tonturas, tremor, agitação, convulsões, coma, náuseas,

vómitos, alteração do ritmo do coração, diminuição da tensão arterial e alteração no

equilíbrio de fluidos/sais do corpo. Leve a embalagem de Escitalopram Apotex

consigo quando for ao médico ou ao hospital.

Caso se tenha esquecido de tomar Escitalopram Apotex

Não tome uma dose a dobrar para compensar uma dose que se esqueceu de tomar.

Se se esquecer de tomar uma dose, e se se lembrar antes de se deitar, tome a dose

de imediato. Continue a tomar a medicação como habitualmente no dia seguinte. Se

apenas se lembrar durante a noite, ou no dia seguinte, ignore a dose esquecida e

continue a tomar a como habitualmente.

Se parar de tomar Escitalopram Apotex

Não pare de tomar Escitalopram Apotex até que o seu médico lhe diga para o fazer.

Quando tiver completado o seu tratamento, é geralmente recomendado que a dose

de Escitalopram Apotex seja gradualmente reduzida ao longo de algumas semanas.

Quando parar de tomar Escitalopram Apotex, especialmente se for de repente, pode

sentir sintomas de descontinuação. Estes são frequentes quando o tratamento com

Escitalopram Apotex é interrompido. O risco é mais elevado, quando Escitalopram

Apotex tiver sido usado durante um longo período de tempo ou em doses elevadas

ou quando a dose é reduzida de forma demasiado rápida. A maioria das pessoas

APROVADO EM

21-01-2021

INFARMED

considera que os sintomas são ligeiros e desaparecem por si em duas semanas.

Contudo, em alguns doentes podem ser mais intensos ou prolongar-se (2-3 meses

ou mais). Se tiver sintomas de descontinuação graves quando parar de tomar

Escitalopram Apotex contate o seu médico. O seu médico pode pedir-lhe para voltar

a tomar os seus comprimidos novamente e deixar de tomá-los mais lentamente.

Os sintomas de descontinuação incluem: sensação de tonturas (instabilidade ou

desequilíbrio),

sensação

formigueiro,

sensação

queimaduras

(menos

frequentemente) sensação de choques elétricos, incluindo na cabeça, perturbações

do sono (sonhos vívidos, pesadelos, incapacidade de dormir), ansiedade, dores de

cabeça,

sensação

mal-estar

(náusea),

suores

(incluindo

suores

noturnos),

sensação de inquietação ou agitação, tremor (instabilidade), sensação de confusão

ou desorientação, sensação de emotividade ou irritabilidade, diarreia (fezes soltas),

perturbações visuais, batimentos do coração agitados ou fortes (palpitações).

Caso ainda tenha dúvidas sobre a utilização deste medicamento, fale com o seu

médico ou farmacêutico.

Efeitos secundários possíveis

Como todos os medicamentos, este medicamento pode causar efeitos secundários,

embora estes não se manifestem em todas as pessoas.

Os efeitos secundários habitualmente desaparecem após algumas semanas de

tratamento. Tenha em atenção o facto de que muitos dos efeitos também podem ser

sintomas da sua doença e portanto podem melhorar quando começar a sentir-se

melhor.

Se sentir qualquer um dos efeitos secundários seguintes deve contactar o seu

médico ou dirigir-se imediatamente ao hospital:

Pouco frequentes (podem afetar até 1 em 100 pessoas):

Hemorragias invulgares, incluindo hemorragias gastrointestinais

Raros (podem afetar até 1 em 1000 pessoas):

Inchaço na pele, língua, lábios ou rosto ou tiver dificuldades na respiração ou a

engolir (reação alérgica);

Febre alta, agitação, confusão, tremores e contrações súbitas dos músculos, estes

podem ser sinais de uma situação rara denominada síndrome serotoninérgico.

Desconhecidos (a frequência não pode ser estimada a partir dos dados disponíveis):

Dificuldade em urinar

Convulsões (ataques), ver também secção “Advertências e precauções”,

Amarelecimento da pele e da parte branca dos olhos são sinais de problemas na

função do fígado/hepatite

Ritmo cardíaco rápido e irregular ou desmaio, os quais podem ser sintomas de uma

situação que pode colocar a vida em risco conhecida como torsades de pointes.

Pensamentos de autoagressão ou suicídio, ver também secção “Advertências e

precauções”.

APROVADO EM

21-01-2021

INFARMED

Além dos efeitos secundários acima mencionados,, foram comunicados os seguintes

efeitos secundários:

Muito frequentes (podem afetar mais de 1 pessoa em 10):

6HQVD©¥RGHPDOHVWDU Q£XVHDV 

'RUGHFDEH©D

Frequentes (pode afetar até 1 em 10 pessoas):

1DUL]HQWXSLGRRXFRPFRUULPHQWR VLQXVLWH 

'LPLQXL©¥RRXDXPHQWRGRDSHWLWH

$QVLHGDGHLQTXLHWD©¥RVRQKRVDQµPDORVGLILFXOGDGHHPDGRUPHFHU

VRQRO¬QFLDWRQWXUDVERFHMRVWUHPRUHVVHQVD©¥RGHIRUPLJXHLURQDSHOH

'LDUUHLDSULV¥RGHYHQWUHYµPLWRVERFDVHFD

$XPHQWRGDVXGD©¥R

'RUHVQRVP¼VFXORVHQDVDUWLFXOD©·HV DUWUDOJLDHPLDOJLD 

3HUWXUED©·HVVH[XDLV DWUDVRQDHMDFXOD©¥RSUREOHPDVFRPDHUH©¥RDSHWLWH

VH[XDOGLPLQX¯GRHPXOKHUHVFRPGLILFXOGDGHHPDWLQJLURRUJDVPR 

)DGLJDIHEUH

$XPHQWRGHSHVR

Pouco frequentes (pode afetar até 1 em 100 pessoas):

8UWLF£ULDHUXS©¥RQDSHOHFRPLFK¥R SUXULGR 

5DQJHURVGHQWHVDJLWD©¥RQHUYRVLVPRDWDTXHVGHS¤QLFRHVWDGRGHFRQIXV¥R

3HUWXUED©¥RGRVRQRDOWHUD©¥RGRSDODGDUGHVPDLR V¯QFRSH 

3XSLODVDXPHQWDGDV PLGU¯DVH SHUWXUED©¥RGDYLV¥R]XPELGRVQRVRXYLGRV

DFXIHQR 

3HUGDGHFDEHOR

6DQJUDPHQWRPHQVWUXDOH[FHVVLYR

3HU¯RGRPHQVWUXDOLUUHJXODU

'LPLQXL©¥RGHSHVR

%DWLPHQWRDFHOHUDGRGRFRUD©¥R

,QFKD©RGRVEUD©RVRXSHUQDV

+HPRUUDJLDGRQDUL]

Raros (pode afetar até 1 em 1000 pessoas):

$JUHVV¥RGHVSHUVRQDOL]D©¥RDOXFLQD©·HV

Leia o documento completo

APROVADO EM

21-01-2021

INFARMED

RESUMO DAS CARACTERÍSTICAS DO MEDICAMENTO

NOME DO MEDICAMENTO

Escitalopram Apotex 5 mg comprimidos orodispersíveis

Escitalopram Apotex 10 mg comprimidos orodispersíveis

Escitalopram Apotex 15 mg comprimidos orodispersíveis

Escitalopram Apotex 20 mg comprimidos orodispersíveis

COMPOSIÇÃO QUALITATIVA E QUANTITATIVA

Escitalopram Apotex 5

mg: cada

comprimido

contém

5 mg

de escitalopram,

equivalente a 6,3875 mg

oxalato de escitalopram

Escitalopram Apotex 10 mg: cada comprimido contém 10 mg de escitalopram,

equivalente a 12,775 mg

oxalato de escitalopram

Escitalopram Apotex 15 mg: cada comprimido contém 15 mg de escitalopram,

equivalente a 19,1625 mg

oxalato de escitalopram

Escitalopram Apotex 20 mg: cada comprimido contém 20 mg de escitalopram,

equivalente a 25,55 mg

oxalato de escitalopram

Excipiente(s) com efeito conhecido:

Cada 5 mg comprimido contém 58,935 mg de lactose mono-hidratada

Cada 10 mg comprimido contém 117,87 mg de lactose mono-hidratada

Cada 15 mg comprimido contém 176,805 mg de lactose mono-hidratada

Cada 20 mg comprimido contém 235,74 mg de lactose mono-hidratada

Lista completa de excipientes, ver secção 6.1.

FORMA FARMACÊUTICA

Comprimido orodispersível

Escitalopram Apotex 5 mg: comprimidos brancos a esbranquiçados, redondos, planos

com bordas em bisel e um diâmetro de 7 mm gravados com “5” de um lado

Escitalopram Apotex 10 mg: comprimidos brancos a esbranquiçados, redondos,

planos com bordas em bisel e um diâmetro de 9 mm gravados com “10” de um lado

Escitalopram Apotex 15 mg: comprimidos brancos a esbranquiçados, redondos,

planos com bordas em bisel e um diâmetro de 11 mm gravados com “15” de um lado

Escitalopram Apotex 20 mg: comprimidos brancos a esbranquiçados, redondos,

planos com bordas em bisel e um diâmetro de 12 mm gravados com “20” de um lado

INFORMAÇÕES CLÍNICAS

APROVADO EM

21-01-2021

INFARMED

Indicações terapêuticas

Tratamento de episódios depressivos major

Tratamento de perturbações de pânico com ou sem agorafobia

Tratamento de perturbação de ansiedade social (fobia social)

Tratamento de perturbação da ansiedade generalizada

Tratamento da perturbação obsessiva-compulsiva

Posologia e modo de administração

A segurança de doses diárias superiores a 20 mg não foi demonstrada.

Modo de administração

Escitalopram Apotex é administrado como uma dose única diária e pode ser tomado

com ou sem alimentos. O comprimido deve ser colocado sobre a língua, onde se

desintegra rapidamente e pode ser engolido sem água. O comprimido orodispersível

é frágil e deve ser manuseado com cuidado.

Escitalopram Apotex comprimido orodispersível é bioequivalente aos comprimidos

revestidos por película de escitalopram, com uma taxa e extensão de absorção

semelhante. Possui a mesma dosagem e frequência de administração que os

comprimidos

revestidos

película

escitalopram.

Escitalopram

Apotex

comprimidos orodispersíveis podem ser utilizados como alternativa aos comprimidos

revestidos por película de escitalopram.

Os comprimidos orodispersíveis são a forma farmacêutica preferencial para doentes

dificuldades

engolir

comprimidos

tradicionais

situações

indisponibilidade de líquidos.

Posologia

Episódios depressivos major

A dose habitual é de 10 mg uma vez por dia. Dependendo da resposta individual do

doente, a dose pode ser aumentada até um máximo de 20 mg por dia.

Normalmente

são

necessárias

semanas

para

obter

resposta

antidepressiva. Após o desaparecimento dos sintomas, é necessário um período de

tratamento de, pelo menos, 6 meses para consolidação da resposta.

Perturbações de pânico com ou sem agorafobia

É recomendada uma dose inicial de 5 mg na primeira semana de tratamento,

aumentando-se depois para 10 mg por dia. A dose pode ser posteriormente

aumentada, até um máximo de 20 mg por dia, dependendo da resposta individual do

doente.

A eficácia máxima é atingida após cerca de 3 meses. O tratamento tem uma duração

de vários meses.

Perturbação de ansiedade social

A dose habitual é de 10 mg uma vez por dia. Habitualmente são necessárias 2 a 4

semanas para obter o alívio dos sintomas. Dependendo da resposta individual do

APROVADO EM

21-01-2021

INFARMED

doente, a dose pode ser diminuída para 5 mg ou aumentada até um máximo de 20

mg por dia.

A perturbação de ansiedade social é uma doença de caráter crónico, sendo desejável

o tratamento durante 12 semanas para consolidação da resposta. O tratamento a

longo prazo de doentes que respondem ao tratamento, foi estudado durante 6

meses, podendo considerar-se que, numa base individual, previne a recaída; os

benefícios do tratamento devem ser reavaliados em intervalos regulares.

A perturbação de ansiedade social corresponde a uma terminologia de diagnóstico

bem definida de uma doença específica que não deve ser confundida com timidez

excessiva.

farmacoterapia

apenas

indicada

esta

perturbação

interferir

significativamente com as atividades profissionais e sociais.

posicionamento

deste

tratamento

comparativamente

terapêutica

comportamental cognitiva não foi avaliado. A farmacoterapia faz parte de uma

estratégia terapêutica global.

Perturbação da ansiedade generalizada

A dose inicial é de 10 mg uma vez por dia. Dependendo da resposta individual do

doente, a dose pode ser aumentada até um máximo de 20 mg por dia.

O tratamento a longo prazo de doentes que responderam à terapêutica foi estudado

durante pelo menos 6 meses em doentes medicados com 20 mg/dia. Os benefícios

do tratamento e a dose devem ser reavaliados em intervalos regulares (ver secção

5.1).

Perturbação obsessiva-compulsiva

A dose inicial é de 10 mg uma vez por dia. Dependendo da resposta individual do

doente, a dose pode ser aumentada até um máximo de 20 mg por dia.

Como a perturbação obsessiva-compulsiva (POC) é uma doença crónica, os doentes

devem ser tratados durante um período suficiente de modo a assegurar que já não

apresentam sintomas.

Os benefícios do tratamento e a dose devem ser reavaliados em intervalos regulares

(ver secção 5.1).

Doentes idosos (> 65 anos de idade)

A dose inicial é de 5 mg uma vez por dia. Dependendo da resposta individual do

doente a dose pode ser aumentada até um máximo de 10 mg por dia (ver secção

5.2).

A eficácia de escitalopram no tratamento da perturbação de ansiedade social não foi

estudada em doentes idosos.

População pediátrica

Escitalopram Apotex não deve ser utilizado no tratamento de crianças e adolescentes

com idade inferior a 18 anos (ver secção 4.4).

Função renal diminuída

APROVADO EM

21-01-2021

INFARMED

Não é necessário ajuste da dose em doentes com compromisso renal ligeiro ou

moderado. É recomendada precaução em doentes com a função renal gravemente

diminuída (Clcr inferior a 30 ml/min) (ver secção 5.2).

Função hepática diminuída

Recomenda-se a utilização de uma dose inicial de 5 mg por dia nas duas primeiras

semanas de tratamento em doentes com afeção hepática ligeira ou moderada.

Dependendo da resposta individual do doente, a dose poderá ser aumentada para 10

mg por dia. É recomendada precaução e especial cuidado na titulação da dose em

doentes com a função hepática gravemente diminuída (ver secção 5.2).

Metabolizadores fracos no que se refere ao CYP2C19

Para doentes que se sabe serem metabolizadores fracos no que se refere ao

CYP2C19, recomenda-se uma dose inicial de 5 mg por dia durante as primeiras duas

semanas de tratamento.

Dependendo da resposta individual do doente, a dose poderá ser aumentada para 10

mg por dia (ver secção 5.2).

Sintomas de descontinuação observados quando se interrompe o tratamento

A descontinuação abrupta do tratamento deve ser evitada. Quando o tratamento

com escitalopram for descontinuado, a dose deve ser gradualmente diminuída

durante um período mínimo de uma a duas semanas, de forma a reduzir o risco de

sintomas de descontinuação (ver secções 4.4 e 4.8). Se, no decurso de uma

diminuição da dose ou da descontinuação do tratamento, ocorrerem sintomas

intoleráveis deverá ser avaliada a necessidade de retomar a dose anteriormente

prescrita. Subsequentemente, o médico poderá continuar com a redução da dose,

mas de forma mais gradual.

Contraindicações

Hipersensibilidade à substância ativa ou a qualquer um dos excipientes mencionados

na secção 6.1.

O tratamento concomitante com inibidores irreversíveis não seletivos da monoamina-

oxidase

(inibidores

MAO),

contraindicado

devido

risco

síndrome

serotoninérgico, que inclui agitação, tremor, hipertermia, etc. (ver secção 4.5).

A combinação de escitalopram com inibidores reversíveis da MAO-A (por exemplo

moclobemida) ou com o inibidor reversível e não seletivo da MAO linezolida, é

contraindicada devido ao risco de desencadear uma síndrome serotoninérgico (ver

secção 4.5).

O escitalopram é contraindicado em doentes com prolongamento do intervalo QT

conhecido ou síndrome do QT longo congénito.

O escitalopram é contraindicado com medicamentos conhecidos por prolongarem o

intervalo QT (ver secção 4.5).

Advertências e precauções especiais de utilização

As seguintes advertências e precauções especiais aplicam-se à classe terapêutica de

Inibidores Seletivos da Recaptação da Serotonina (ISRS).

APROVADO EM

21-01-2021

INFARMED

População pediátrica

Escitalopram Apotex não deve ser utilizado no tratamento de crianças e adolescentes

idade

inferior

anos.

Foram

observados

maior

frequência

comportamentos

relacionados

suicídio

(tentativa

suicídio

ideação

suicida), e hostilidade (predominantemente agressão, comportamento de oposição e

cólera) em ensaios clínicos com crianças e adolescentes que se encontravam a tomar

antidepressores, em comparação com os que se encontravam atomar placebo. Se,

não obstante, com base na necessidade clínica, a decisão de tratamento for tomada,

o doente deve ser rigorosamente monitorizado em relação ao aparecimento de

sintomas suicidas. Não estão disponíveis dados de segurança a longo prazo em

crianças

adolescentes

refere

crescimento,

maturação

desenvolvimento cognitivo e comportamental.

Ansiedade paradoxal

Alguns doentes com perturbação de pânico podem experimentar sintomas de maior

ansiedade no início do tratamento com antidepressores. Esta reação paradoxal

normalmente resolve-se dentro de duas semanas durante o tratamento continuado.

É recomendada uma dose inicial baixa, de modo a reduzir a probabilidade de um

efeito ansiogénico (ver secção 4.2).

Convulsões

O escitalopram deve ser descontinuado se um doente desenvolver convulsões pela

primeira vez, ou se existir um aumento da frequência de convulsões (em doentes

com diagnóstico prévio de epilepsia). Os ISRS devem ser evitados em doentes com

epilepsia instável e os doentes com epilepsia controlada devem ser rigorosamente

monitorizados.

Mania

ISRS

devem

utilizados

precaução

doentes

história

mania/hipomania. Os ISRS devem ser descontinuados em qualquer doente que entre

em fase maníaca.

Diabetes

Em doentes com diabetes, o tratamento com ISRS pode alterar o controlo glicémico

(hipoglicemia ou hiperglicemia). Pode haver necessidade de proceder ao ajuste das

doses de insulina e/ou de hipoglicemiantes orais.

Suicídio/ideação suicida ou agravamento clínico

depressão

está

associada

aumento

risco

ideação

suicida,

autoagressividade e suicídio (pensamentos/ comportamentos relacionados com o

suicídio). O risco prevalece até que ocorra uma remissão significativa dos sintomas.

Como durante as primeiras semanas, ou mais, de tratamento pode não se verificar

qualquer melhoria, os doentes deverão ter uma vigilância mais rigorosa até que essa

melhoria ocorra. De acordo com a prática clínica, em geral, o risco de suicídio pode

aumentar nas fases iniciais de recuperação.

Os outros distúrbios psiquiátricos, para os quais o escitalopram é prescrito, podem

estar igualmente associados ao aumento do risco de ideação/comportamentos

relacionados com o suicídio. Adicionalmente, estas situações podem ser comórbidas

com os distúrbios depressivos major. Consequentemente, no tratamento de doentes

APROVADO EM

21-01-2021

INFARMED

com outros distúrbios psiquiátricos, deverão ser tomadas as mesmas precauções que

aquando da terapêutica de doentes com distúrbios depressivos major.

Os doentes com história de pensamentos/comportamentos relacionados com o

suicídio, ou que apresentem um grau significativo destes sintomas antes do início do

tratamento, são conhecidos por apresentarem um maior risco de ter ideação suicida

tentativas

suicídio,

devendo,

este

motivo,

cuidadosamente

monitorizados durante o tratamento. Uma meta-análise de estudos clínicos de

antidepressores controlados com placebo, em doentes adultos com perturbações

psiquiátricas, demonstrou existir um aumento do risco de comportamento suicida

com os antidepressores em comparação com o placebo em doentes com idade

inferior a 25 anos.

terapêutica

farmacológica

deve

acompanhada

monitorização

cuidadosa

doentes,

particular

naqueles

apresentam

maior

risco,

especialmente na fase inicial de tratamento e após as alterações posológicas

subsequentes. Os doentes (e os seus prestadores de cuidados de saúde) devem ser

alertados

para

necessidade

monitorizar

qualquer

agravamento

clínico,

comportamento ou ideação suicida e alterações pouco habituais no comportamento e

de procurar assistência médica imediatamente caso estes ocorram.

Acatisia/agitação psicomotora

A administração de ISRS/ISRN tem sido associada ao desenvolvimento de acatisia,

caracterizada

agitação

subjetivamente

desconfortável

perturbadora,

necessidade de movimento, frequentemente acompanhada por incapacidade do

doente se sentar ou permanecer em repouso. Esta situação é mais frequente nas

primeiras semanas de tratamento. Nos doentes que desenvolvem estes sintomas, o

aumento da dose pode ser prejudicial.

Hiponatremia

A hiponatremia, causada provavelmente pela secreção inapropriada da hormona

antidiurética (SIADH), tem sido raramente descrita com o uso de ISRS e, de um

modo geral, é resolvida com a descontinuação da terapêutica. É recomendada

precaução em doentes de risco, tais como os idosos, ou doentes com cirrose, ou

quando utilizado em associação com outros medicamentos que possam provocar

hiponatremia.

Hemorragia

Foram

notificados

casos

perturbações

hemorrágicas

cutâneas

associadas

utilização de ISRS, tais como equimoses e púrpura. É recomendada precaução em

doentes

medicados

ISRS,

especial

utilização

concomitante

anticoagulantes

orais,

medicamentos

conhecidos

afetarem

função

plaquetária (por exemplo antipsicóticos atípicos e fenotiazinas, a maior parte dos

antidepressores tricíclicos, ácido acetilsalicílico e anti-inflamatórios não esteroides

(AINE),

ticlopidina

dipiridamol),

como

doentes

predisposição

conhecida para perturbações hemorrágicas. Os ISRS/ISRN podem aumentar o risco

de hemorragia pós-parto (ver secções 4.6 e 4.8).

ECT (terapia eletroconvulsiva)

A experiência clínica de administração concomitante de ISRS e ECT é limitada e, por

conseguinte, é recomendada precaução.

APROVADO EM

21-01-2021

INFARMED

Síndrome serotoninérgico

É recomendada precaução caso o escitalopram seja utilizado concomitantemente

com medicamentos com efeitos serotoninérgicos, tais como o sumatriptano ou

outros triptanos, tramadol e triptofano.

Em casos raros, foi descrita a síndrome serotoninérgica em doentes que utilizam

ISRS concomitantemente com medicamentos serotoninérgicos. A combinação de

sintomas tais como agitação, tremor, mioclonia e hipertermia pode indicar o

desenvolvimento

desta

situação.

ocorrer,

tratamento

ISRS

medicamentos serotoninérgicos devem ser imediatamente interrompidos e iniciado

um tratamento sintomático.

Hipericão

utilização

concomitante

ISRS

compostos

fitoterapêuticos

contendo

hipericão (Hypericum perforatum) pode resultar num aumento da incidência de

reações adversas (ver secção 4.5).

Sintomas de descontinuação observados quando se interrompe o tratamento

Os sintomas de descontinuação observados quando se interrompe o tratamento são

frequentes, em particular se a descontinuação é feita de forma abrupta (ver secção

4.8). Nos ensaios clínicos, os acontecimentos adversos observados durante a

descontinuação do tratamento ocorreram em aproximadamente 25% dos doentes

tratados com escitalopram e 15% de doentes a tomar placebo.

O risco de ocorrência de sintomas de descontinuação poderá depender de vários

fatores incluindo a duração do tratamento, a dose administrada e a taxa de redução

da dose. As reações mais frequentemente notificadas são tonturas, distúrbios

sensoriais (incluindo parestesia e sensações de choque elétrico), distúrbios do sono

(incluindo insónia e sonhos intensos), agitação ou ansiedade, náuseas e/ou vómitos,

tremor, confusão, sudação, cefaleias, diarreia, palpitações, instabilidade emocional,

irritabilidade e perturbações visuais. Geralmente estes sintomas são de intensidade

ligeira a moderada; contudo, em alguns doentes podem ser intensos.

Estes sintomas ocorrem geralmente durante os primeiros dias de descontinuação do

tratamento, no entanto também têm sido notificadas muito raramente em doentes

que falharam inadvertidamente uma toma do medicamento.

De um modo geral, estes sintomas são autolimitados e desaparecem normalmente

dentro de 2 semanas, apesar de em alguns indivíduos se poderem prolongar (2-3

meses

mais).

Consequentemente,

aconselhável

redução

gradual

escitalopram quando o tratamento é descontinuado durante um período de várias

semanas ou meses, de acordo com as necessidades do doente (ver “Sintomas de

descontinuação observados quando se interrompe o tratamento”, na secção 4.2).

Doença cardíaca coronária

Atendendo a que a experiência clínica disponível é ainda limitada, é aconselhada

precaução nos doentes com doença cardíaca coronária (ver secção 5.3).

Prolongamento do intervalo QT

O escitalopram demonstrou causar um prolongamento do intervalo QT dependente

da dose. Foram notificados, na fase pós-comercialização, casos de prolongamento do

intervalo QT e arritmia ventricular, incluindo torsade de pointes, predominantemente

em doentes do sexo feminino, com hipocaliemia, ou com um prolongamento do

APROVADO EM

21-01-2021

INFARMED

intervalo QT pré-existente ou outras doenças cardíacas (ver secções 4.3, 4.5, 4.8,

4.9 e 5.1)

Recomenda-se particular precaução no caso de doentes com bradicardia significativa,

enfarte agudo do miocárdio recente ou insuficiência cardíaca descompensada.

Os distúrbios eletrolíticos como hipocaliemia e hipomagnesemia aumentam o risco de

arritmias malignas e devem ser corrigidos antes do início do tratamento com

escitalopram.

Deve ser ponderada a realização de um ECG antes de se iniciar o tratamento com

escitalopram em doentes com doença cardíaca estável.

Se ocorrer algum sinal de arritmia cardíaca durante o tratamento com escitalopram,

este deve ser descontinuado e deve ser realizado um ECG.

Glaucoma de ângulo fechado

Os ISRS incluindo o escitalopram podem ter um efeito sobre o tamanho das pupilas,

que pode resultar em midríase. Este efeito midriático tem o potencial de estreitar o

ângulo ocular, resultando num aumento da pressão intraocular e glaucoma de ângulo

fechado, especialmente nos doentes predispostos. Portanto, o escitalopram deve ser

utilizado

precaução

doentes

glaucoma

ângulo

fechado

antecedentes de glaucoma.

Este medicamento contém lactose. Os doentes com problemas hereditários raros de

intolerância à galactose, deficiência de lactase de Lapp ou má absorção de glucose-

galactose não devem tomar este medicamento.

Interações medicamentosas e outras formas de interação

Interações farmacodinâmicas

Associações contraindicadas

IMAO irreversíveis não-seletivos

Foram notificados casos de reações graves em doentes medicados com um ISRS em

associação com um inibidor da monoaminoxidase (IMAO) irreversível não seletivo e

em doentes que descontinuaram recentemente um tratamento com um ISRS e

começaram o tratamento com um IMAO (ver secção 4.3). Em alguns casos, os

doentes desenvolveram síndrome serotoninérgico (ver secção 4.8).

O escitalopram está contraindicado em combinação com IMAO irreversíveis não

seletivos.

tratamento

escitalopram

pode

iniciado

dias

após

descontinuação do tratamento com um IMAO irreversível. Devem passar, pelo

menos, 7 dias após a descontinuação do tratamento com escitalopram, antes do

início do tratamento com um IMAO irreversível não seletivo.

Inibidor reversível e seletivo da MAO-A (moclobemida)

Atendendo

risco

desenvolvimento

síndrome

serotoninérgico,

contraindicada a combinação de escitalopram com um inibidor da MAO-A, como a

moclobemida (ver secção 4.3). Se tal combinação se mostrar necessária, esta deverá

ser iniciada na dose mínima recomendada, devendo reforçar-se a monitorização

clínica.

APROVADO EM

21-01-2021

INFARMED

Inibidor reversível não seletivo da MAO (linezolida)

O antibiótico linezolida é um inibidor reversível não seletivo da MAO e não deve ser

administrado a doentes em tratamento com escitalopram. Se tal combinação se

mostrar necessária, devem ser utilizadas as doses mínimas, devendo reforçar-se a

monitorização clínica (ver secção 4.3).

Inibidor irreversível seletivo da MAO-B (selegilina)

É necessária precaução na administração concomitante com selegilina (inibidor

irreversível

MAO-B)

atendendo

risco

desenvolvimento

síndrome

serotoninérgico.

Doses

selegilina

até

mg/dia

foram

administradas

concomitantemente e com segurança com a mistura racémica de citalopram.

Prolongamento do intervalo QT

Não foram efetuados estudos de interação farmacocinéticos ou farmacodinâmicos de

escitalopram em combinação com outros medicamentos conhecidos por prolongar o

intervalo QT. O efeito aditivo de escitalopram e destes medicamentos não pode ser

excluído.

Deste

modo,

administração

concomitante

escitalopram

medicamentos conhecidos por prolongar o intervalo QT, tal como antiarrítmicos de

classe IA e III, antipsicóticos (por exemplo, derivados da fenotiazina, pimozida,

haloperidol),

antidepressores

tricíclicos,

alguns

agentes

antimicrobianos

(por

exemplo, esparfloxacina, moxifloxacina, eritromicina IV, pentamidina, antimaláricos

(particularmente a halofantrina), alguns anti-histamínicos (astemizol, mizolastina), é

contraindicada.

Associações requerendo precauções de utilização

Medicamentos serotoninérgicos

A administração concomitante com medicamentos serotoninérgicos (por exemplo,

tramadol, sumatriptano e outros triptanos) pode levar ao aparecimento de síndrome

serotoninérgico.

Medicamentos que diminuem o limiar convulsivo

Os ISRS podem diminuir o limiar convulsivo. É aconselhada precaução ao utilizar

concomitantemente outros medicamentos capazes de diminuir o limiar convulsivo

(por

exemplo

antidepressores

(tricíclicos,

ISRS),

neurolépticos

(fenotiazinas,

tioxantenos e butirofenonas), mefloquina, bupropiona e tramadol).

Lítio, triptofano

Tem havido notificações de aumento do efeito quando foram administrados ISRS

juntamente com lítio ou triptofano; como tal a administração concomitante de ISRS

com aqueles medicamentos deve ser feita com precaução.

Hipericão

A utilização concomitante de ISRS e produtos fitoterapêuticos contendo hipericão

(Hypericum perforatum) pode resultar num aumento da incidência de reações

adversas (ver secção 4.4).

Hemorragia

A administração concomitante de escitalopram e anticoagulantes orais pode provocar

alteração

efeitos

anticoagulantes.

doentes

medicados

anticoagulantes

orais

devem

cuidadosamente

monitorizados

quanto

APROVADO EM

21-01-2021

INFARMED

parâmetros de coagulação quando a administração de escitalopram é iniciada ou

descontinuada (ver secção 4.4).

A administração concomitante de anti-inflamatórios não esteroides (AINEs) pode

aumentar a tendência hemorrágica (ver secção 4.4).

Álcool

Não são esperadas quaisquer interações farmacodinâmicas ou farmacocinéticas entre

escitalopram

álcool.

Contudo,

semelhança

outros

medicamentos

psicotrópicos, é aconselhada a combinação com o álcool.

Medicamentos que induzem hipocaliemia/hipomagnesemia

Recomenda-se precaução com a utilização concomitante de medicamentos que

induzam hipocaliemia/hipomagnesemia pois estas condições aumentam o risco de

arritmias malignas (ver secção 4.4).

Interações farmacocinéticas

Influência de outros medicamentos na farmacocinética do escitalopram

O metabolismo do escitalopram é maioritariamente mediado pelo CYP2C19. O

CYP3A4 e o CYP2D6 podem também contribuir para o metabolismo, mas numa

extensão inferior. O metabolismo do metabolito principal S-DCT (escitalopram

desmetilado) aparenta ser parcialmente catalisado pelo CYP2D6.

A administração concomitante de escitalopram com 30 mg de omeprazole uma vez

inibidor

CYP2C19)

resultou

aumento

moderado

(aproximadamente 50%) nas concentrações plasmáticas de escitalopram.

A administração concomitante de escitalopram com 400 mg de cimetidina, duas

vezes por dia (um inibidor enzimático, geral, moderadamente potente) resultou num

aumento moderado (aproximadamente 70%) das concentrações plasmáticas de

escitalopram. É recomendada precaução quando se administra escitalopram em

associação com cimetidina. Pode ser necessário proceder a ajuste posológico.

Assim,

deve

haver

precaução

quando

administrado

concomitantemente

inibidores

CYP2C19

(por

exemplo,

omeprazol,

esomeprazol,

fluvoxamina,

lansoprazol, ticlopidina) ou cimetidina. Pode ser necessária uma redução na dose de

escitalopram de acordo com a monitorização de efeitos secundários durante o

tratamento concomitante.

Efeitos do escitalopram na farmacocinética de outros medicamentos

O escitalopram é um inibidor da enzima CYP2D6. É recomendada precaução na

administração

concomitante

escitalopram

medicamentos

sejam

metabolizados

essencialmente

esta

enzima,

apresentem

índice

terapêutico estreito, por exemplo, flecainida, propafenona e metoprolol (quando

utilizados na insuficiência cardíaca), ou alguns medicamentos com atuação ao nível

do SNC que sejam metabolizados essencialmente pelo CYP2D6, por exemplo,

antidepressores como desipramina, clomipramina e nortriptilina e antipsicóticos

como risperidona, tioridazina e haloperidol. Pode ser necessário proceder-se a um

ajuste posológico.

Leia o documento completo

APROVADO EM

05-11-2014

INFARMED

Summary Public Assessment Report

Generics

Escitalopram Apotex

5 mg, 10 mg, 15 mg, 20 mg, Orodisperdible

tablets

(escitalopram, oxalate)

PT/H/0897/001-004/DC

Date: 05-11-2014

APROVADO EM

05-11-2014

INFARMED

Summary Public Assessment Report

Generics

Escitalopram Apotex

Escitalopram, oxalate, 5 mg, 10 mg, 15 mg, 20 mg, Orodispersible

tablets

This is a summary of the public assessment report (PAR) for Escitalopram Apotex. It

explains how Escitalopram Apotex was assessed and its authorisation recommended

as well as its conditions of use. It is not intended to provide practical advice on how to

use Escitalopram Apotex.

For practical information about using Escitalopram Apotex, patients should read the

package leaflet or contact their doctor or pharmacist.

What is Escitalopram Apotex and what is it used for?

Escitalopram Apotex is a ‘generic medicine’. This means that Escitalopram Apotex is

similar to a ‘reference medicine’ already authorised in the European Union (EU) called

Cipralex.

Escitalopram Apotex contains escitalopram and is used to treat depression (major

depressive episodes) and anxiety disorders (such as panic disorder with or without

agoraphobia, social anxiety disorder, generalised anxiety disorder and obsessive-

compulsive disorder).

How does Escitalopram Apotex work?

Escitalopram Apotex belongs to a group of antidepressants called selective serotonin

reuptake inhibitors (SSRIs). These medicines act on the serotonin-system in the brain

by increasing the serotonin level. Disturbances in the serotonin-system are considered

an important factor in the development of depression and related diseases.

How is Escitalopram Apotex used?

The pharmaceutical form of Escitalopram Apotex is orodispersible tablets and the

route of administration is oral.

Please read section 3 of the PL for detailed information on dosing recommendations,

the route of administration, and the duration of treatment.

The medicine can only be obtained with a prescription.

What benefits of Escitalopram Apotex have been shown in studies?

Because Escitalopram Apotex is a generic medicine, studies in patients have been

limited to tests to determine that it is bioequivalent to the reference medicine,

Cipralex. Two medicines are bioequivalent when they produce the same levels of the

active substance in the body.

APROVADO EM

05-11-2014

INFARMED

What are the possible side effects of Escitalopram Apotex?

Because Escitalopram Apotex is a generic medicine and is bioequivalent to the

reference medicine, its benefits and possible side effects are taken as being the same

as the reference medicine. For the full list of restrictions, see the package leaflet.

Why is Escitalopram Apotex approved?

It was concluded that, in accordance with EU requirements, Escitalopram Apotex has

been

shown

have

comparable

quality

bioequivalent

Cipralex.

Therefore, the INFARMED, I.P. decided that, as for Cipralex, the benefits are greater

than its risk and recommended that it can be approved for use.

Other information about Escitalopram Apotex

The marketing authorisation for Escitalopram Apotex was granted on

05-11-2014.

The full PAR for Escitalopram Apotex can be found on the website

www.infarmed.pt/infomed

. For more information about treatment with

Escitalopram Apotex, read the package leaflet or contact your doctor or

pharmacist.

This summary was last updated in MM-YYYY.

APROVADO EM

05-11-2014

INFARMED

Public Assessment Report

Scientific discussion

Escitalopram Apotex

5 mg, 10 mg, 15 mg, 20 mg, Orodisperdible

tablets

(escitalopram, oxalate)

PT/H/0897/001-004/DC

This module reflects the scientific discussion for the approval of Escitalopram

Apotex.

The procedure was

finalised at 26-08-2013. For information on

changes after this date please refer to the module ‘Update’.

APROVADO EM

05-11-2014

INFARMED

Introduction

Based on the review of the quality, safety and efficacy data, the Member States have

agreed in granting a marketing authorisation for Escitalopram Apotex 5 mg, 10 mg, 15

mg and 20 mg Orodispersible tablets, from Apotex.

The product is indicated for: the treatment of major depressive episodes, panic

disorder

with

without

agoraphobia,

social

anxiety

disorder

(social

phobia);

generalised anxiety disorder and obsessive-compulsive disorder.

A comprehensive description of the indications and posology is given in the SmPC.

The originator product is Cipralex 5 mg, film-coated tablets, Cipralex Odis, 10 mg

orodispersible tablet, Cipralex 15 mg, film-coated tablets and Cipralex Odis, 20 mg

orodispersible tablet by H. Lundbeck A/S, registered since 21-02-2003 (5 mg and 15

mg strengths) and 09-03-2010 (10 mg and 20 mg strengths).

The marketing authorisation has been granted pursuant to Article 10.1 of Directive

2001/83/EC.

This type of application refers to information that is contained in the pharmacological-

toxicological and clinical part of the dossier of the authorisation of the reference

product. A reference product is a medicinal product authorised and marketed on the

basis

full

dossier,

i.e.

including

chemical,

biological,

pharmaceutical,

pharmacological-toxicological and clinical data. This information is not fully available in

the public domain. Authorisations for generic products are therefore only allowed once

the data protection time of the dossier of the reference product has expired. For this

kind of application, it has to be demonstrated that the pharmacokinetic profile of the

product is similar to the pharmacokinetic profile of the reference product. This generic

product can be used instead of its reference product.

Quality aspects

Introduction

Escitalopram Apotex is white to off-white round, flat tablets with beveled edges.

Each tablet contains 5 mg, 10 mg or 15 mg or 20 mg of escitalopram.

Blister Packs (Peelable paper/PET/aluminium-PVC/aluminium/OPA) of 12, 14, 20, 28,

50, 56, 60, 98, 100 & 200 orodispersible tablets.

The excipients are:

Cellulose, microcrystalline

Lactose monohydrate

Croscarmellose sodium

Polacrilin potassium

Acesulfame potassium

Neohesperidine-dihydrochalcone

Magnesium stearate

Peppermint flavor [containing Maltodextrin (maize), Modified starch E1450 (waxy

maize) and Peppermint oil (mentha arvensis)]

Hydrochloric acid concentrated (for pH adjustment)

APROVADO EM

05-11-2014

INFARMED

Drug Substance

Escitalopram, oxalate

A white to an off white crystalline powder, freely soluble in methanol and in dimethyl

sulfoxide, sparingly soluble in water and in alcohol, very slightly soluble in ethyl

acetate and in isopropyl alcohol and insoluble in heptane.

chemical-pharmaceutical

documentation

Expert

Report

relation

escitalopram oxalate

are of sufficient quality in view of the present European

regulatory requirements.

Medicinal Product

The documentation provided complies with relevant EU guidelines and directives.

Manufacture is performed in accordance with cGMP and consistency in quality and

homogeneity is demonstrated.

The finished product specification is based on relevant development and stability

studies. The development of the product has been described, the choice of excipients

is justified and their functions explained.

Appropriate validation data have been provided for the analytical methods. Batch

analyses data support the proposed finished product specification.

The conditions used in the stability studies are according to the ICH stability guideline. The control

tests and specifications for drug product are adequately drawn up.

The proposed shelf-life of 30 months for the drug product with no special temperature

storage requirements and storing in the original package in order to protect from

moisture and light is considered acceptable

Non-clinical aspects

The pharmacodynamic, pharmacokinetic and toxicological properties of escitalopram

are well known. As escitalopram is a widely used, well-known active substance, the

applicant has not provided additional studies and further studies are not required. An

overview based on literature review is, thus, appropriate.

Environmental Risk Assessment (ERA)

An Environmental Risk Assessment has not been performed as the product is intended

for generic substitution, however ERA omission has been justified. A disposal advice

APROVADO EM

05-11-2014

INFARMED

has been added to the SmPC.

Clinical aspects

To support the application, the applicant has submitted one bioequivalence study

titled: “A Single-Dose, Randomized, Open-Label, Crossover, Pivotal, Comparative

Bioavailability Study of Escitalopram 20 mg Orodispersible Tablets and Cipralex® 20

Film-Coated Tablets in Healthy Male and Female Volunteers under Fasting

Conditions” (Study code: 1433).

Pharmacovigilance system

The RMS considers that the pharmacovigilance system as described by the applicant

fulfils the requirements and provides adequate evidence that the applicant has the

services of a qualified person responsible for pharmacovigilance and has the necessary

means for the notification of any adverse reaction suspected of occurring either in the

Community or in a third country. The summary concerning the EU qualified person for

Pharmacovigilance (QPPV) and the location of the PSMF is included in the updated

181-phvig-system.

Risk Management Plan

The current application for authorization concerns the generic version of Cipralex

(escitalopram),

Lundbeck,

medicinal

product

human

that

been

authorized in the European Union since 2001. The product is also marketed in

countries outside the European Union since many years.

As a result, the safety profile of escitalopram containing medicinal products is well

established and has maintained a positive benefit/risk ratio after many years of

extensive patient exposure. The innovator has not implemented any special measures

for risk minimisation for escitalopram containing medicinal products.

Therefore the applicant proposes to use the routine pharmacovigilance system, as

described in Volume 9A of the Rules governing medicinal products in the European

Union, and does not plan to install for Escitalopram 5, 10, 15 and 20 mg oro-

dispaersible tablets special measures for risk minimization.

The applicant has a Pharmacovigilance system in place including a Drug Safety

database with electronic reporting facilities, Standard Operating Procedures, Work

Instructions, trained staff, etc. meeting the current pharmacovigilance standards.

User consultation

The package leaflet has been evaluated in accordance with the requirements of

Articles 59(3) and 61(1) of Directive 2001/83/EC. The language used for the purpose

of user testing the PIL was English.

The results show that the package leaflet meets the criteria for readability as set out

in the Guideline on the readability of the label and package leaflet of medicinal

products for human use.

APROVADO EM

05-11-2014

INFARMED

Overall

conclusion,

benefit/risk

assessment

recommendation

Based on the review of the data on quality, safety and efficacy, the RMS considered

that the application for Escitalopram Apotex 5 mg, 10 mg, 15 mg and 20 mg,

orodispersible tablets, is approvable

Produtos Similares

Pesquisar alertas relacionados a este produto

Ver histórico de documentos

Compartilhe esta informação