סילריל 2.5

ישראל - עברית - Ministry of Health

קנה את זה

עלון מידע עלון מידע (PIL)

30-11-2020

מרכיב פעיל:
CILAZAPRIL
זמין מ:
UNIPHARM LTD, ISRAEL
קוד ATC:
C09AA08
טופס פרצבטיות:
טבליה
הרכב:
CILAZAPRIL 2.5 MG
מסלול נתינה (של תרופות):
פומי
סוג מרשם:
מרשם נדרש
תוצרת:
TRIMA ISRAEL PHARMACEUTICAL PRODUCTS MAABAROT LTD, ISRAEL
קבוצה תרפויטית:
CILAZAPRIL
איזור תרפויטי:
CILAZAPRIL
סממני תרפויטית:
A blood pressure lowering agent. Chronic heart failure.
leaflet_short:
Cilazapril, Fosinopril, Moexipril, Ramipril
מספר אישור:
135 93 31305 00
תאריך אישור:
2012-01-31

מסמכים בשפות אחרות

עלון מידע עלון מידע - אנגלית

17-08-2016

ציבור דו ציבור דו"ח הערכה - אנגלית

18-08-2016

עלון מידע עלון מידע - ערבית

30-11-2020

םיחקורה תונקת יפל ןכרצל ןולע

1986- ו"משתה )םירישכת(

לירליס

תוילבט

אפור םשרמב תבייח וז הפורת

הפורתב י/שמתשת םרטב ופוס דע ןולעה תא ןויעב י/ארק

ודי-לע רשואו קדבנ ונכותו תואירבה דרשמ י"ע עבקנ הז ןולע טמרופ

:בכרה

Cilazapril 1 mg :הליכמ1לירליסלש הילבט לכ

זוטקל ג"מ184הליכמ הילבט לכ ,ןכ ומכו

Cilazapril 2.5 mg :הליכמ2.5לירליסלש הילבט לכ

זוטקל ג"מ183הליכמ הילבט לכ ,ןכ ומכו

Cilazapril 5 mg :הליכמ5לירליסלש הילבט לכ

זוטקל ג"מ182הליכמ הילבט לכ ,ןכ ומכו

:םיליעפ יתלב םיביכרמ

Lactose,Maizestarch,Hydroxypropylmethylcellulose,Sodiumstearylfumarate,

Colorant.

)Angiotensin Converting Enzyme) ACE יבכעמ:תיטיופרת הצובק

)CHF) תינורכ בל תקיפס יאבו םד ץחל רתיב לופיטל:תיאופר תוליעפ

?רישכתב שמתשהל ןיא יתמ

.הקינימ וא ןוירהב ךניה רשאכ הפורתב ישמתשת לא

תצובקמתורחאתופורתלואהיביכרממדחאלתושיגרהעודיםאוזהפורתבשמתשהלןיא

יבכעמ

,ןושלה,םינפהלשתוחפנתה(המדאויגנאמרבעבתלבסםאוזהפורתבשמתשהלןיא

יבכעמ תצובקמ תורחא תופורתב לופיט רחאל )ןורגה

.)ןטבה ללחב םילזונ( תמייממ ת/לבוס ךניה םא וז הפורתב שמתשהל ןיא

ץחלתדרוהלתופורתבת/לפוטמותרכוסמת/לבוסךניהםאוזהפורתבשמתשהלןיא

.ןריקסילא תוליכמה םד

:לופיטה תלחתה ינפל אפורב ץעוויהל ילבמ הפורתב שמתשהל ןיא

רתימ,תרכוסמ,ןתשהתכרעמ/הילכה,דבכה:דוקפתביוקילמרבעבתלבסואת/לבוסךניהםא

רורקדואהשוחתרסוח,תונבצע,רידסאלבלבצק,לובלב:ןוגכתועפותבןייפואמ(םדבןגלשא

.)םיילגרב תודבכ וא השלוח ,המישנ יישק וא רצוק ,םייתפשב וא םיילגרה תופכב ,םיידיב

.לופיטה ךשמהל סחיב אפורב ץעוויהל ךיילע ,לופיטה תפוקתב תורהל ךתנווכב םא

.הזילאידב םילפוטמה םילוח ,ןרתנ תלד הטאיד לע םירמושה םילוח

.)"תורהזא" י/האר( םילושלש וא תואקהמ הנורחאל תלבס םא

.סופולמ םילבוסה םילוח

תופורתבת/לפוטמותוילכדוקפתבתויעבמת/לבוסךניהוהדימבאפורהתאעדיילשי

.ןריקסילא תוליכמה םד ץחל תדרוהל

?ךלש םוי םויה ייח לע הפורתה עיפשת ךיא

ןכלעולופיטהתליחתבדחוימב,תרוחרחסלםורגלואתונריעבםוגפללולעוזהפורתבשומישה

.תונריע תבייחמה תוליעפ לכבו תונכוסמ תונוכמ תלעפהב ,בכרב הגיהנב תוריהז בייחמ

םרגיהללולעורחאמהפורתהםעלופיטהתפוקתבםיפירחתואקשמואתונייתותשלןיא

.דואמ ךומנ םד ץחל

:תורהזא

.זוטקלל םישיגרה םישנא לצא היגרלאל םורגל לולעו זוטקל ליכמ רישכתה

.דואמ ךומנ םד ץחלל םורגל הלולע וז הפורת

ךכיפל,םדץחלתדיריבתאטבתמההפורתהלשתרבגומהעפשהןכתיתהנושארההנמב

.הביכשב הנושארה הנמה תא לוטיל ץלמומ

ץחלברתיתדרוהלםורגללולעםילושלשואהאקה,תרבגומהעזהןוגכםיבצמבםילזונדוביא

.תקפסמ הייתש לע דיפקהל שי ולא םירקמב - םד

ידוקפת,ןתש,םדתוקידבךורעלשיוזהפורתבלופיטהתפוקתבולופיטהתלחתהינפל

.םד ץחל רתיל בקעמו הילכ

תליטנינפלאפורלךכלעעידוהלךילע,יהשלכהפורתלואוהשלכןוזמלה/שיגרךניהםא

.הפורתה

אפורלחוודלשי,המדרהבהכורכההלועפוא)ילטנדללוכ(חותינרובעלת/דמועךניהםא

תמדקומתוצעייתהאללןגלשאםיליכמהחלמיפילחתואןגלשאתופסותבשמתשהלןיא

.אפורה םע

עוציבינפלאפורהתאעדיילשי.ןתשוםדתקידבתואצותלעעיפשהלהלולעהפורתה

.הלא תוקידב

לופיטהתעהזתרמגםאוא,תפסונהפורתת/לטונךניהםא:תויתפורת-ןיבתובוגת

ידכלפטמהאפורלחוודלךילע,הנוזתיפסותוםשרמאללתופורתללוכ,תרחאהפורתב

תוצובקהמתופורתיבגלדחוימב,תויתפורת-ןיבתובוגתמםיעבונהתוליעי-יאואםינוכיסעונמל

לועישדגנתופורת,םדץחלתדרוהלתופסונתופורת;)םדץחלתדרוהל(ןריקסילא:תואבה

ןוגכ,םיבאכתלקהל(תוידיאורטסןניאשתוקלדתודגונתופורת,תונתשמתופורת,תוננטצהו

םירישכת/תויטטסוטיצתופורת,)ןודגישל(לונירופולא,)תיבטוק-ודהערפהל(םויתיל,)ןיריפסא

תרכוסלתופורת,)בלל(דימאניאקורפ,םידיאורטסוקיטרוק,תינוסיחהתכרעמהתאםיאכדמה

ךניהםא,)חלמיפילחתןוגכ(ןגלשאםיליכמהםירישכת,)הפהךרדןתמבםירישכת,ןילוסניא(

.הצמוח ירתוס ,תוערצ וא םירובד תוציקע לשב לופיט ת/רבוע

עיפוהלתולולעהבשומישהןמזב,הפורתהלשהיוצרהתוליעפלףסונב:יאוולתועפות

,לוכיעבתוערפה,תופייע,תרוחרחס,הליחב,לושלש,החירפ,שארבאכ:ןוגכ,יאוולתועפות

תושיגר,רעישתרישנ,ןורגבאכ,לועיש,םיקרפמ/םירירשיבאכ,ןובאיתרסוח,םעטביוניש

.הניש תוערפה ,הקמסה ,תונוא-ןיא ,תרבגומ העזה ,רואל תרבגומ

.רישכתל תולגתסהה תפוקת רחאל רצק ןמז ךות ללכ ךרדב תופלוח ולא תועפות

:תדחוימ תוסחייתה תובייחמה תועפות

ללוכ(תורומחרועתויעב,סיטיסוניס,ןושלבאכ,תויסטואתונבל,תומודאםדתוירודכבהדירי

!דימאפורלי/הנפ:)רידנ(םירבגבהזחתלדגה,םיינרופיצתופפורתה,)תופלקתהואתויחופלש

לופיטהתאי/ךשמה:)רידנ(המישניישקוןושל,םייניע,םייתפש:ללוכ,םינושםירביאבתקצב

,)בלףקתהלםורגללולעוןופליעואתרוחרחסבאטבתמה(םדץחלתת!דימאפורלי/הנפו

ואהמישניישק,באכבהוולמואהפוכתןתשתלטה,רידסאלואריהמבלבצק,הזחבבאכ

הנבה,רובידבישוק,םיילגרוםיידי,םינפבהשוחתרסוחןוגכ(ץבשלשםינמיס,ימדלועיש

] intestinalangioedema [ימואתפןטבבאכ(,)ימואתפשארבאכ,הייאררסוח,העילבוא

ןוגכ(יטקליפנאקושלשתועפות!דימאפורלי/הנפ:)רידנ()] pancreatitis [בלבלתקלדוא

!דימאפורלי/הנפ:)בלהבצקבהטאה,ךומנםדץחל,המישנרצוק,החירפ,שארבאכ,הליחב

ואםירירשיבאכ,)םוח,ןורגבאכ:ןוגכ(םוהיזינמיס,רומחלושלש,תורומחתואקהותוליחב

!דימ אפורל י/הנפ :)רידנ( )דבכב תויעב( םייניעה וא רועה תבהצה ,םיקרפמ יבאכ

ךתשגרהביונישלחםאוא,הזןולעבוניוצאלשיאוולתועפותה/שיגרמךניהובשהרקמלכב

.דימ אפורה םע ץעייתהל ךילע ,תיללכה

תדעוימהניאוזהפורת.תצלמומההנמהלערובעלןיא.דבלבאפורהתוארוהיפלןונימ:ןונימ

ידי-לעעבקנשיפכםיבוצקםינמזבוזהפורתבשמתשהלשי.תוקוניתוםידלילללכךרדב

ךא,תרכזנשכדימהנמלוטילשי,בוצקןמזבוזהפורתלוטילתחכשםא.לפטמהאפורה

!דחיב תונמ יתש לוטיל ןיא ןפוא םושב

תדימב.החוראירחאואינפל,םימטעמםעהפורתהתאעולבל!סועללןיא:שומישהןפוא

לכבהפורתהתאתחקליוצר.ידיימשומישרובע,הילבטהתאשותכלואתוצחלןתינךרוצה

.רקובב ףידע ,העש התואב ךרעב םוי

?לופיטה תחלצהל עייסל י/לכות דציכ

ןיאךתואירבבצמברופישלחםאםג.אפורהידי-לעץלמוהשלופיטהתאםילשהלךילע

.אפור םע תוצעייתה אלל הפורתב לופיטה תא קיספהל

!הלערהי/ענמ

תוקוניתוא/וםידלילשםדיגשיהלץוחמרוגסםוקמברומשלשיתרחאהפורתלכווזהפורת

י/הנפ,הפורתהןמדליעלבתועטבםאוארתיתנמתלטנםא.הלערהי/ענמתךכידי-לעו

הארוהאללהאקהלםורגלןיא.ךתיאהפורתהתזיראי/אבהו,םילוח-תיבלשןוימרדחלדימ

.קיזהלהלולעאיהת/רחאהלוחב,ךתלחמבלופיטלהמשרנוזהפורת!אפורמתשרופמ

תיוותהקודבלשי!ךשוחבתופורתלוטילןיא.ךירכמואךינכש,ךיבורקלוזהפורתי/ןתיתלא

.םהל ה/קוקז ךניה םא םייפקשמ ביכרהל שי .הפורת ת/לטונ ךניהשםעפ לכבהנמהו

הנסחאה/הזיראהיאנתיפלםג.רואמןגומםוקמבו25 ° C -לתחתמןסחאלשי:הנסחא

לשהגופתהךיראתלבלםישלאנ.דבלבתלבגומהפוקתלתורמשנתופורת,םיצלמומה

.הפורתה תא ךל קפיסש חקורב ץעוויהל ךילע ,קפס לש הרקמ לכב !רישכתה

.הזירא התואב תונוש תופורת ןסחאל ןיא

:הפורתה םושיר 'סמ

136013149500 :1לירליס

135933130500:2.5לירליס

135943128200 :5לירליס

.ביבא-לת ,21429.ד.ת ,מ"עב םראפינוא רובע ,תורבעמ ץוביק ,מ"עב המירת:ןרצי

0712D

PATIENT PACKAGE INSERT IN ACCORDANCE WITH

THE PHARMACISTS'REGULATIONS (PREPARATIONS) - 1986

Cilaril

Tablets

The dispensing of this medicine requires a doctor's prescription

Read this package insert carefully in its entirety before using this medicine

TheformatofthisleafletwasdeterminedbytheMinistryofHealthanditscontentwas

checked and approved

Composition:

EachCilaril 1tablet contains: Cilazapril 1 mg

In addition, each tablet contains 184 mg lactose

EachCilaril 2.5tablet contains: Cilazapril 2.5 mg

In addition, each tablet contains 183 mg lactose

EachCilaril 5tablet contains: Cilazapril 5 mg

In addition, each tablet contains 182 mg lactose

Inactiveingredients:Lactose,Maizestarch,Hydroxypropylmethylcellulose,Sodium

stearyl fumarate, Colorant.

Therapeutic group:ACE)Angiotensin Converting Enzyme) inhibitors.

Therapeutic activity:For treatment of hypertension and chronic heart failure (CHF).

When should the preparation not be used?

Do not use this medicine if you are pregnant or breastfeeding.

Donotusethismedicineifthereisaknownsensitivitytoanyofitsingredientsorto

other medicines from the ACE inhibitor group.

Donotusethismedicineifyouhavesufferedinthepastfromangioedema(swelling

oftheface,tongue,throat)aftertreatmentwithothermedicinesfromtheACEinhibitor

group.

Do not use this medicine if you suffer from ascites (fluids in the abdominal cavity).

Donotusethismedicineifyousufferfromdiabetesandarebeingtreatedwith

antihypertensives that contain aliskiren.

Do not take this medicine without consulting a doctor before starting treatment:

Ifyouaresuffering,orhavesufferedinthepast,fromimpairedfunctionof:theliver,the

kidney/urinarytract,fromdiabetes,fromhyperkalemia(characterizedbyeffectssuchas:

confusion,irregularheartbeat,nervousness,numbnessorprickinginthehands,feetor

lips, shortness of breath or difficulty breathing, weakness or heaviness in the legs).

Ifyouintendtobecomepregnantduringtreatmentwiththismedicine,youmustconsult

the doctor about continuing treatment.

Patients on a low-sodium diet, patients who are undergoing dialysis.

If you have recently suffered from vomiting or diarrhea (see “Warnings”).

Patients suffering from lupus.

Informthedoctorifyouhavekidneyfunctionproblemsandareundertreatmentwith

antihypertensives that contain aliskiren.

How will this medicine affect your daily life?

Useofthismedicinemayimpairalertnessorcausedizziness,especiallyinthebeginning

ofthetreatment;therefore,cautionshouldbeexercisedwhendrivingacar,operating

dangerous machinery and in any other activity which requires alertness.

Donotdrinkwineorotheralcoholicbeverageswhileundertreatmentwiththismedicine,

as this may cause very low blood pressure.

Warnings:Thepreparationcontainslactoseandmaycauseanallergicreactioninpatients

sensitive to lactose.

This medicine may cause very low blood pressure.

Withthefirstdose,theremaybeanincreasedeffectofthemedicine,manifestedbyadrop

in blood pressure; therefore, it is recommended to take the first dose in a lying position.

Lossoffluidsresultingfromincreasedsweating,vomitingordiarrheamayleadtoan

excessive drop in blood pressure - in these cases be sure to drink adequately.

Beforestartingtreatmentandwhileundertreatmentwiththismedicine,thefollowingtests

should be performed: blood, urine, kidney function and monitoring for hypertension.

Ifyouaresensitivetoanytypeoffoodormedicine,informyourdoctorbeforecommencing

treatment with this medicine.

Ifyouareabouttoundergosurgery(includingdentalsurgery)oranyprocedureinvolving

anesthesia, inform the doctor (anesthesiologist) that you are taking this medicine.

Donotusepotassiumsupplementsorpotassium-containingsaltsubstituteswithoutfirst

consulting your doctor.

Thismedicinemayinterferewiththeresultsofbloodandurinetests.Notifythedoctor

Druginteractions:Ifyouaretakinganotherdrugconcomitantlyorifyouhavejust

finishedtreatmentwithanothermedicine,includingnon-prescriptionmedicinesand

foodsupplements,informtheattendingdoctor,inordertopreventhazardsorlackof

efficacyarisingfromdruginteractions.Thisisespeciallyimportantformedicinesbelonging

tothefollowinggroups:aliskiren(anantihypertensive);otherantihypertensives,cough

andcoldmedicines,diuretics,non-steroidalanti-inflammatorydrugs(forreliefofpain,

suchasaspirin),lithium(forbipolardisorder),allopurinol(forgout),cytostaticmedicines/

immunosuppressants,corticosteroids,procainamide(fortheheart),medicinesfordiabetes

(insulin,oralpreparations),potassium-containingpreparations(suchassaltsubstitutes),

if you are undergoing treatment due to bee or wasp stings, antacids.

Sideeffects:Inadditiontothedesiredeffectofthemedicine,adversereactionsmay

occurduringthecourseoftakingthismedicine,forexample:headache,rash,diarrhea,

nausea,dizziness,tiredness,digestivedisturbances,changeintaste,lackofappetite,

muscle/jointpains,cough,sorethroat,hairloss,increasedsensitivitytolight,increased

sweating,impotence,flushing,sleepdisturbances.Thesesideeffectsusuallydisappear

within a short time following the period of adaptation to the medicine.

Side effects that require special attention:

Adecreaseinred,whitebloodcellsorplatelets,tonguepain,sinusitis,severeskinproblems

(includingblistersorpeeling),looseningofnails,breastenlargementinmen(rare):refer

to the doctor immediately!

Edemaindifferentpartsofthebody,including:thelips,eyes,tongue,andbreathing

difficulties (rare): continue treatment and refer to the doctor immediately!

Hypotension(manifestedbydizzinessorfaintingandmayleadtoheartattack),chestpain,

rapidorirregularheartbeat,frequentorpainfulurination,breathingdifficultiesorcoughing

withblood,signsofstroke(suchasnumbnessoftheface,armsandlegs,difficultyspeaking,

understandingorswallowing,lossofvision,suddenheadache),(suddenabdominalpain

[intestinal angioedema] or pancreatitis) (rare): refer to the doctor immediately!

Anaphylacticshockeffects(suchasnausea,headache,rash,shortnessofbreath,low

blood pressure, slowed heartbeat): refer to the doctor immediately!

Severenauseaandvomiting,severediarrhea,signsofinfection(suchassorethroat,

fever),musclepainsorjointpains,yellowingoftheskinoreyes(liverproblems)(rare):

refer to the doctor immediately!

Intheeventthatyouexperiencesideeffectsnotmentionedinthisleaflet,orifthereisa

change in your general health, consult your doctor immediately.

Dosage:Dosage is according to doctor’s instructions only.

Do not exceed the recommended dose.

This medicine is not usually intended for children and infants.

Thismedicineistobetakenatspecifictimeintervalsasdeterminedbytheattending

doctor.Ifyouforgettotakethismedicineatthespecifiedtime,takethedoseassoonas

you remember, but never take a double dose to compensate for a missed one!

Directionsforuse:Donotchew!Swallowthemedicinewithasmallamountofwater,

beforeorafterameal.Ifnecessary,thetabletcanbehalvedorcrushed,forimmediate

use.Itisadvisabletotakethemedicineataboutthesametimeeachday,preferablyin

the morning.

How can you contribute to the success of the treatment?

Complete the full course of treatment as instructed by the doctor.

Evenifthereisanimprovementinyourhealth,donotdiscontinuetreatmentwiththis

medicine without consulting your doctor.

Avoidpoisoning!Thismedicine,andallothermedicines,mustbestoredinasafeplace

out of the reach of children and/or infants, to avoid poisoning.

Ifyouhavetakenanoverdose,orifachildhasaccidentallyswallowedthemedicine,

proceedimmediatelytoahospitalemergencyroomandbringthepackageofthemedicine

withyou.Donotinducevomitingunlessexplicitlyinstructedtodosobyadoctor!This

medicinehasbeenprescribedforthetreatmentofyourailment;inanotherpatientitmay

cause harm.Do not give this medicine to your relatives, neighbors or acquaintances.

Donottakemedicinesinthedark!Checkthelabelandthedoseeachtimeyoutakeyour

medicine. Wear glasses if you need them.

Storage:Store below 25°C in a place protected from light.

Evenifkeptintheiroriginalcontainerandstoredasrecommended,medicinesmaybe

keptforalimitedperiodonly.Pleasenotetheexpirydateofthemedicine!Incaseof

doubt,consultthepharmacistwhodispensedthemedicinetoyou.Donotstoredifferent

medications in the same package.

License number:Cilaril 1:136013149500

Cilaril 2.5:135933130500

Cilaril 5:135943128200

Manufacturer:Trima Ltd., Kibbutz Maabarot, for Unipharm Ltd., P.O.B. 21429, Tel-Aviv.

0712D

מוצרים דומים

חיפוש התראות הקשורות למוצר זה

צפו בהיסטוריית המסמכים

שתף מידע זה