Tranquiline 35mg/ml Oral Gel for Dogs

Main information

  • Trade name:
  • Tranquiline 35mg/ml Oral Gel for Dogs
  • Pharmaceutical form:
  • Oral gel
  • Medicine domain:
  • Animals
  • Medicine type:
  • Allopathic drug

Documents

Localization

  • Available in:
  • Tranquiline 35mg/ml Oral Gel for Dogs
    Austria
  • Language:
  • English

Therapeutic information

  • Therapeutic group:
  • Acepromazine
  • Therapeutic area:
  • Dogs Non Food

Other information

Status

  • Source:
  • HMA - Europe
  • Authorization number:
  • IE/V/0278/001
  • Authorization date:
  • 23-11-2011
  • EU code:
  • IE/V/0278/001
  • Last update:
  • 09-08-2016

Summary of Product characteristics: dosage,interactions,side effects

SummaryofProductCharacteristics

1NAMEOFTHEVETERINARYMEDICINALPRODUCT

Tranquiline35mg/mlOralGelforDogs.

2QUALITATIVEANDQUANTITATIVECOMPOSITION

Eachmlcontains:

Forafulllistofexcipients,seesection6.1.

3PHARMACEUTICALFORM

Oralgel.

Clearyellowgel.

4CLINICALPARTICULARS

4.1TargetSpecies

Dogs.

4.2Indicationsforuse,specifyingthetargetspecies

Forsedationandanaestheticpre-medication.

Neuroleptanalgesiaincombinationwithamorphinederivative.

Anti-emeticeffect,symptomatictherapyincaseofvomitingandmotionsickness.

4.3Contraindications

Donotuseindogsweighinglessthan17.5kgbodyweight.

Donotuseinanimalsinshock,insevereemotionalexcitation,withanexistingtendencytoconvulsionorduringStatus

epilepticus.

Donotuseincaseofhypersensitivitytotheactivesubstanceoranyoftheexcipients.

4.4Specialwarningsforeachtargetspecies

Acepromazinecanprecipitatefaintinginbrachycephalicdogs.Largebreedsofdogareparticularlysensitiveto

acepromazineandtheminimumdosepossibleshouldbeusedinthesebreeds.

4.5Specialprecautionsforuse

Specialprecautionsforuseinanimals

Activesubstance

Acepromazine

(asAcepromazinemaleate) 35.00mg

(47.50mg)

Excipients

Preservatives

Methylparahydroxybenzoate(E218) 0.65mg

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 06/03/2012 CRN 7010059 page number: 1

Specialprecautionstobetakenbythepersonadministeringtheveterinarymedicinalproducttoanimals

Incaseofaccidentalingestion,seekmedicaladviceimmediatelyinformingthehealthprofessionalsofphenothiazine

poisoning.Showthepackageleafletorthelabeltothedoctor.DONOTDRIVEassedationandchangesinblood

pressuremayoccur.

Peoplewithknownhypersensitivitytoacepromazineorotherphenothiazinesshouldavoidcontactwiththeveterinary

medicinalproduct.

Personswithsensitiveskinorinfrequentcontactwiththeproductareadvisedtowearimpermeablegloves.

Washhandsandexposedskinthoroughlyafteruse.

Incaseofaccidentalspillageontotheskin,immediatelyafterexposurewashtheexposedskinwithlargeamountsof

water.

Avoidcontactwitheyes.Ifaccidentaleyecontactoccurs,flushgentlywithrunningwaterfor15minutesandseek

medicaladviceifanyirritationpersists.

4.6Adversereactions(frequencyandseriousness)

Sinceacepromazinedecreasessympatheticnervoussystemtone,atransientdropinbloodpressuremayoccurafter

administration.

Inhibitionoftemperatureregulation.

Thefollowingreversiblechangesarepossibleinthehaemogram:

-transientdecreaseinerythrocytecountandhaemoglobinconcentration;

-transientdecreaseinthrombocyteandleukocytecounts.

Becauseitincreasesprolactinsecretion,theadministrationofacepromazinemayleadtodisturbancesinfertility.

4.7Useduringpregnancy,lactationorlay

Teratologicaleffectsaftertheuseofacepromazineinbitcheshave,todate,notbeenreported.However,asnospecific

studyonteratologicaleffectsexists,theuseofacepromazineduringpregnancyisnotrecommendedandshouldonly

takeplacefollowingasuitablebenefit/riskassessmentbytheresponsibleveterinarysurgeon.

4.8Interactionwithothermedicinalproductsandotherformsofinteraction

Acepromazinepotentiatestheactionofcentrallydepressantdrugs.

Thesimultaneoususeoforganicphosphateestersincreasesthetoxicityofacepromazine.

Sinceacepromazinedecreasessympatheticnervoussystemtone,theproductshouldnotbegivenatthesametimeas

bloodpressurereducingdrugs.

4.9Amountstobeadministeredandadministrationroute

Dosageguidelines

Theproductisfilledintoa10mlpolyethylenesyringe.Theflangedplungerhasalockingringwhichshouldbe

adjustedtosupplythevolumerequiredinaccordancewiththedosageguidelines.1.0mlintervalsareprintedonthe

syringeplunger,buttheplungerisindented/flangedatintervalsof0.5ml.Asingleturnofthelockingringwillmove

theringbackwardsallowingadosevolumeof0.5mltobeexpelled.Twoturnsofthelockingringwillsupplyadose

volumeof1.0ml.Threeturnsofthelockingringarerequiredforadoseof1.5ml.

Indication Dose Dosevolume

Slightsedation 1.0mg/kg 0.5ml ½thesingleoraldose/17.5kgbodyweight

Sedation 2.0mg/kg 1.0ml Singleoraldose/17.5kgbodyweight

Pre-medication 3.0mg/kg 1.5ml 1½timesthesingleoraldose/17.5kg

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 06/03/2012 CRN 7010059 page number: 2

Thepalatablegelcanalsobemixedwithfood.

4.10Overdose(symptoms,emergencyprocedures,antidotes),ifnecessary

Overdosageresultsinanearlieronsetofthesedativesymptomsandinaprolongedeffect.

Toxiceffectsareataxia,hypotension,hypothermiaandextrapyramidaleffects.

Antidote:Noradrenalinecanbeusedtocounteractthecardiovasculareffects.

Possibleantidotetoapnoeaandsyncopewhichmayoccur-methylamphetamineandsolublesteroid.

4.11WithdrawalPeriod(s)

Notapplicable.

5PHARMACOLOGICALorIMMUNOLOGICALPROPERTIES

Therapeuticgroup: NervousSystem

ATCvetcode: QN05AA04

5.1Pharmacodynamicproperties

Acepromazineisaphenothiazinederivative.Thisgroupofmoleculesbelongstotheneuroleptics:theydepressthe

centralnervoussystemandexertassociatedeffectsontheautonomicsystem.Theseeffectsareduetotheirinterference

withdifferentneurotransmitterreceptors(dopaminergic,adrenergic)andtotheirinterferencewithhypothalamic

performance.Thesedativeactivitystartswithin15to30minutesoftreatmentandlastsfor6-7hours.

5.2Pharmacokineticproperties

Acepromazineispartlyabsorbedfromthegastrointestinaltract.Plasmaproteinbindingishighanditisextensively

distributedthroughoutthebodytissues.Plasmalevelsareusuallylow.Acepromazineishighlymetabolised,withthe

urineasthemainrouteofexcretion.

6PHARMACEUTICALPARTICULARS

6.1Listofexcipients

Methylparahydroxybenzoate(E218)

Propylparahydroxybenzoate(E216)

Sodiumacetatetrihydrate

Sodiumcyclamate(E952)

Hydroxyethylcellulose

Glycerol(E422)

Purifiedwater

6.2Incompatibilities

Intheabsenceofcompatibilitystudies,thisveterinarymedicinalproductmustnotbemixedwithotherveterinary

medicinalproducts.

6.3Shelf-life

Shelf-lifeoftheveterinarymedicinal

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 06/03/2012 CRN 7010059 page number: 3

Shelf-lifeafterfirstopeningthe

immediatepackaging: 28days

Keepthebroachedsyringeintheoriginalcartonandstoreinadryplace.

6.4Specialprecautionsforstorage

Donotstoreabove25°C.

Donotrefrigerateorfreeze.

Protectfromlight.

6.5Natureandcompositionofimmediatepackaging

6.6Specialprecautionsforthedisposalofunusedveterinarymedicinalproductsorwastematerials

Anyunusedveterinarymedicinalproductorwastematerialsderivedfromsuchveterinarymedicinalproductsshouldbe

disposedofinaccordancewithlocalrequirements.

7MARKETINGAUTHORISATIONHOLDER

FlorisVeterinaireProduktenBV

Kempenlandstraat33

5262GKVught

TheNetherlands

8MARKETINGAUTHORISATIONNUMBER(S)

VPA10492/001/001

9DATEOFTHEFIRSTAUTHORISATION/RENEWALOFTHEAUTHORISATION

2ndMarch2012

Container: White,high-densitypolyethylenesyringebarrel.

White,low-densitypolyethylenesyringeplunger.

Closure: White,high-densitypolyethylene,push-fitcap.

Fillvolume: 10ml

Dosingdevice: Theproductispresentedinanoraldosingsyringewhichisgraduatedat1

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 06/03/2012 CRN 7010059 page number: 4

3-11-2018

Janssen Issues Voluntary Nationwide Recall for one lot of ORTHO-NOVUM 1/35 and two lots of ORTHO-NOVUM 7/7/7 Due to Incorrect Veridate Dispenser Instructions

Janssen Issues Voluntary Nationwide Recall for one lot of ORTHO-NOVUM 1/35 and two lots of ORTHO-NOVUM 7/7/7 Due to Incorrect Veridate Dispenser Instructions

Janssen Pharmaceuticals, Inc. has initiated a voluntary recall of one lot of ORTHO-NOVUM 1/35 (norethindrone / ethinyl estradiol) Tablets and two lots of ORTHO-NOVUM 7/7/7 (norethindrone / ethinyl estradiol) Tablets to the pharmacy level. The patient information provided inside affected packages of ORTHO-NOVUM does not include the appropriate instructions for the Veridate dispenser.

FDA - U.S. Food and Drug Administration

29-8-2018

Risk to human and animal health related to the presence of 4,15‐diacetoxyscirpenol in food and feed

Risk to human and animal health related to the presence of 4,15‐diacetoxyscirpenol in food and feed

Published on: Thu, 16 Aug 2018 00:00:00 +0200 4,15‐Diacetoxyscirpenol (DAS) is a mycotoxin primarily produced by Fusarium fungi and occurring predominantly in cereal grains. As requested by the European Commission, the EFSA Panel on Contaminants in the Food Chain (CONTAM) assessed the risk of DAS to human and animal health related to its presence in food and feed. Very limited information was available on toxicity and on toxicokinetics in experimental and farm animals. Due to the limitations in the avai...

Europe - EFSA - European Food Safety Authority Publications

29-6-2018

UPDATE: FDA Animal Drug Safety Communication: FDA continues to warn about risk of accidental overdosing of dogs with the noise aversion drug Sileo

UPDATE: FDA Animal Drug Safety Communication: FDA continues to warn about risk of accidental overdosing of dogs with the noise aversion drug Sileo

FDA is alerting dog owners and veterinarians about the risk of accidental overdose to dogs treated with the drug Sileo, a prescription gel that is given to dogs by mouth to treat noise aversion.

FDA - U.S. Food and Drug Administration

7-6-2018

Minister Bruno Bruins (Sport) opent Special Olympics 2018

Minister Bruno Bruins (Sport) opent Special Olympics 2018

Dit weekend worden in de Achterhoek de Special Olympics Nationale Spelen gehouden. Meer dan 2000 sporters met een verstandelijke beperking gaan de strijd aan in 20 takken van sport. Sportminister Bruno Bruins zal de Spelen vrijdagavond officieel openen tijdens een feestelijke ceremonie in Stadion de Vijverberg in Doetinchem. Bruno Bruins: ‘Sporten is gezond en vooral leuk. Ik vind het belangrijk dat iedereen kan sporten en er lol aan beleeft. Dat is ook een belangrijk onderdeel van het sportakkoord dat i...

Netherlands - Ministerie van Volksgezondheid, Welzijn en Sport