COVERSYL ARGININE PLUS

Main information

  • Trade name:
  • COVERSYL ARGININE PLUS
  • Dosage:
  • 5/ 1.25 Milligram
  • Pharmaceutical form:
  • Film Coated Tablet
  • Medicine domain:
  • Humans
  • Medicine type:
  • Allopathic drug

Documents

Localization

  • Available in:
  • COVERSYL ARGININE PLUS
    Ireland
  • Language:
  • English

Status

  • Source:
  • HPRA - Health Products Regulatory Authority - Ireland
  • Authorization number:
  • PPA1151/085/001
  • Authorization date:
  • 14-11-2008
  • Last update:
  • 14-10-2016

Summary of Product characteristics: dosage, interactions, side effects

SummaryofProductCharacteristics

1NAMEOFTHEMEDICINALPRODUCT

CoversylArgininePlus5mg/1.25mgFilm-coatedTablets

2QUALITATIVEANDQUANTITATIVECOMPOSITION

Eachfilm-coatedtabletcontains3.395mgperindoprilequivalentto5mgperindoprilarginineand1.25mgindapamide.

Excipients:lactosemonohydrate

Forafulllistofexcipients,seesection6.1.

3PHARMACEUTICALFORM

Film-coatedtablet.

ProductimportedfromtheUK,HungaryandPoland

White,rod-shapedfilm-coatedtablet.

4CLINICALPARTICULARS

4.1TherapeuticIndications

Treatmentofessentialhypertension,COVERSYLARGININEPLUS5mg/1.25mgfilm-coatedtabletisindicatedinpatients

whosebloodpressureisnotadequatelycontrolledonperindoprilalone.

4.2Posologyandmethodofadministration

Oralroute

OneCOVERSYLARGININEPLUS5mg/1.25mgfilm-coatedtabletperdayasasingledose,preferablytobetakeninthe

morning,andbeforeameal.

Whenpossibleindividualdosetitrationwiththecomponentsisrecommended.COVERSYLARGININEPLUS5mg/1.25mgfilm-

coatedtabletshouldbeusedwhenbloodpressureisnotadequatelycontrolledonCOVERSYLARGININEPLUS2.5mg/0.625mg

film-coatedtablet(whereavailable).Whenclinicallyappropriate,directchangefrommonotherapytoCOVERSYLARGININE

PLUS5mg/1.25mgfilm-coatedtabletmaybeconsidered.

Elderly(seesection4.4)

Treatmentshouldbeinitiatedafterconsideringbloodpressureresponseandrenalfunction.

Patientswithrenalimpairment(seesection4.4)

Insevererenalimpairment(creatinineclearancebelow30ml/min),treatmentiscontraindicated.

Inpatientswithmoderaterenalimpairment(creatinineclearance30-60ml/min),itisrecommendedtostarttreatmentwiththe

adequatedosageofthefreecombination.

Inpatientswithcreatinineclearancegreaterthanorequalto60ml/min,nodosemodificationisrequired.Usualmedicalfollow-up

willincludefrequentmonitoringofcreatinineandpotassium.

Patientswithhepaticimpairment(seesections4.3,4.4and5.2)

Inseverehepaticimpairment,treatmentiscontraindicated.

Inpatientswithmoderatehepaticimpairment,nodosemodificationisrequired.

Childrenandadolescents

COVERSYLARGININEPLUS5mg/1.25mgshouldnotbeusedinchildrenandadolescentsastheefficacyandtolerabilityof

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 1

4.3Contraindications

-Linkedtoperindopril:

-HypersensitivitytoperindopriloranyotherACEinhibitor

-Historyofangioedema(Quincke'soedema)associatedwithpreviousACEinhibitortherapy

-Hereditary/idiopathicangioedema

-Secondandthirdtrimestersofpregnancy(seesection4.6)

-Linkedtoindapamide:

-Hypersensitivitytoindapamideortoanyothersulphonamides

-Severerenalimpairment(creatinineclearancebelow30ml/min)

-Hepaticencephalopathy

-Severehepaticimpairment

-Hypokalaemia

-Asageneralrule,thismedicineisinadvisableincombinationwithnonantiarrhythmicagentscausingtorsadesdepointes(see

section4.5)

-Lactation(seesection4.6).

-LinkedtoCOVERSYLARGININEPLUS5mg/1.25mg:

-Hypersensitivitytoanyoftheexcipients

Duetothelackofsufficienttherapeuticexperience,COVERSYLARGININEPLUS5mg/1.25mgshouldnotbeusedin:

-Dialysispatients

-Patientswithuntreateddecompensatedheartfailure.

4.4Specialwarningsandprecautionsforuse

Specialwarnings

Commontoperindoprilandindapamide:

Lithium:

Thecombinationoflithiumandthecombinationofperindoprilandindapamideisusuallynotrecommended(see

section4.5).

Linkedtoperindopril:

Neutropenia/agranulocytosis:

Neutropenia/agranulocytosis,thrombocytopeniaandanaemiahavebeenreportedinpatientsreceivingACEinhibitors.

Inpatientswithnormalrenalfunctionandnoothercomplicatingfactors,neutropeniaoccursrarely.Perindoprilshould

beusedwithextremecautioninpatientswithcollagenvasculardisease,immunosuppressanttherapy,treatmentwith

allopurinolorprocainamide,oracombinationofthesecomplicatingfactors,especiallyifthereispre-existingimpaired

renalfunction.Someofthesepatientsdevelopedseriousinfectionswhichinafewinstancesdidnotrespondto

intensiveantibiotictherapy.Ifperindoprilisusedinsuchpatients,periodicalmonitoringofwhitebloodcellcountsis

advisedandpatientsshouldbeinstructedtoreportanysignofinfection(e.g.sorethroat,fever).

Hypersensitivity/angioedema:

Angioedemaoftheface,extremities,lips,tongue,glottisand/orlarynxhasbeenreportedrarelyinpatientstreatedwith

angiotensinconvertingenzymeinhibitors,includingperindopril.Thismayoccuratanytimeduringtreatment.Insuch

casesperindoprilshouldbediscontinuedpromptlyandappropriatemonitoringshouldbeinstitutedtoensurecomplete

resolutionofsymptomspriordismissingthepatient.Inthoseinstanceswhereswellinghasbeenconfinedtotheface

andlipstheconditiongenerallyresolvedwithouttreatment,althoughantihistamineshavebeenusefulinrelieving

symptoms.

Angioedemaassociatedwithlaryngealoedemamaybefatal.Wherethereisinvolvementofthetongue,glottisor

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 2

airwayobstruction,appropriatetherapy,whichmayincludesubcutaneousepinephrinesolution1:1000(0.3mlto0.5ml)

and/ormeasurestoensureapatentairway,shouldbeadministeredpromptly.

BlackpatientsreceivingACEinhibitorshavebeenreportedtohaveahigherincidenceofangioedemacomparedto

non-blacks.

PatientswithahistoryofangioedemaunrelatedtoACEinhibitortherapymaybeatincreasedriskofangioedemawhile

receivinganACEinhibitor(seesection4.3).

IntestinalangioedemahasbeenreportedrarelyinpatientstreatedwithACEinhibitors.Thesepatientspresentedwith

abdominalpain(withorwithoutnauseaorvomiting);insomecasestherewasnopriorfacialangioedemaandC-1

esteraselevelswerenormal.TheangioedemawasdiagnosedbyproceduresincludingabdominalCTscan,or

ultrasoundoratsurgeryandsymptomsresolvedafterstoppingtheACEinhibitor.Intestinalangioedemashouldbe

includedinthedifferentialdiagnosisofpatientsonACEinhibitorspresentingwithabdominalpain.

Anaphylactoidreactionsduringdesensitisation:

Therehavebeenisolatedreportsofpatientsexperiencingsustained,life-threateninganaphylactoidreactionswhile

receivingACEinhibitorsduringdesensitisationtreatmentwithhymenoptera(bees,wasps)venom.ACEinhibitors

shouldbeusedwithcautioninallergicpatientstreatedwithdesensitisation,andavoidedinthoseundergoingvenom

immunotherapy.HoweverthesereactionscouldbepreventedbytemporarywithdrawalofACEinhibitorforatleast24

hoursbeforetreatmentinpatientswhorequirebothACEinhibitorsanddesensitisation.

AnaphylactoidreactionsduringLDLapheresis:

Rarely,patientsreceivingACEinhibitorsduringorlowdensitylipoprotein(LDL)-apheresiswithdextransulphatehave

experiencedlife-threateninganaphylactoidreactions.ThesereactionswereavoidedbytemporarilywithholdingACE-

inhibitortherapypriortoeachapheresis.

Haemodialysispatients:

Anaphylactoidreactionshavebeenreportedinpatientsdialysedwithhigh-fluxmembranes(e.g.,AN69®)andtreated

concomitantlywithanACEinhibitor.Inthesepatientsconsiderationshouldbegiventousingadifferenttypeof

dialysismembraneoradifferentclassofantihypertensiveagent.

Potassium-sparingdiuretics,potassiumsalts:

Thecombinationofperindoprilandpotassium-sparingdiuretics,potassiumsaltsisusuallynotrecommended(see

section4.5).

Pregnancyandlactation:

ACEinhibitorsshouldnotbeinitiatedduringpregnancy.UnlesscontinuedACEinhibitortherapyisconsidered

essential,patientsplanningpregnancyshouldbechangedtoalternativeanti-hypertensivetreatmentswhichhavean

establishedsafetyprofileforuseinpregnancy.Whenpregnancyisdiagnosed,treatmentwithACEinhibitorsshouldbe

stoppedimmediately,and,ifappropriate,alternativetherapyshouldbestarted(seesections4.3and4.6).

Useofperindoprilisnotrecommendedduringbreastfeeding.

Linkedtoindapamide:

Whenliverfunctionisimpaired,thiazidediureticsandthiazide-relateddiureticsmaycausehepaticencephalopathy.

Administrationofthediureticshouldbestoppedimmediatelyifthisoccurs.

Photosensitivity:

Casesofphotosensitivityreactionshavebeenreportedwiththiazidesandrelatedthiazidesdiuretics(seesection4.8).If

photosensitivityreactionoccursduringtreatment,itisrecommendedtostopthetreatment.Ifare-administrationofthe

diureticisdeemednecessary,itisrecommendedtoprotectexposedareastothesunortoartificialUVA.

Precautionsforuse

Commontoperindoprilandindapamide:

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 3

Incasesofsevererenalimpairment(creatinineclearance<30ml/min),treatmentiscontraindicated.

Incertainhypertensivepatientswithoutpre-existingapparentrenallesionsandforwhomrenalbloodtestsshow

functionalrenalinsufficiency,treatmentshouldbestoppedandpossiblyrestartedeitheratalowdoseorwithone

constituentonly.

Inthesepatientsusualmedicalfollow-upwillincludefrequentmonitoringofpotassiumandcreatinine,aftertwoweeks

oftreatmentandtheneverytwomonthsduringtherapeuticstabilityperiod.Renalfailurehasbeenreportedmainlyin

patientswithsevereheartfailureorunderlyingrenalfailureincludingrenalarterystenosis.

Thedrugisusuallynotrecommendedincaseofbilateralrenalarterystenosisorasinglefunctioningkidney.

Hypotensionandwaterandelectrolytedepletion:

Thereisariskofsuddenhypotensioninthepresenceofpre-existingsodiumdepletion(inparticularinindividualswith

renalarterystenosis).Thereforesystematictestingshouldbecarriedoutforclinicalsignsofwaterandelectrolyte

depletion,whichmayoccurwithanintercurrentepisodeofdiarrhoeaorvomiting.Regularmonitoringofplasma

electrolytesshouldbecarriedoutinsuchpatients.

Markedhypotensionmayrequiretheimplementationofanintravenousinfusionofisotonicsaline.

Transienthypotensionisnotacontraindicationtocontinuationoftreatment.Afterre-establishmentofasatisfactory

bloodvolumeandbloodpressure,treatmentcanbestartedagaineitheratareduceddoseorwithonlyoneofthe

constituents.

Potassiumlevels:

Thecombinationofperindoprilandindapamidedoesnotpreventtheonsetofhypokalaemiaparticularlyindiabetic

patientsorinpatientswithrenalfailure.Aswithanyantihypertensiveagentcontainingadiuretic,regularmonitoringof

plasmapotassiumlevelsshouldbecarriedout.

Excipients:

COVERSYLARGININEPLUS5mg/1.25mgshouldnotbeadministeredtopatientswithrarehereditaryproblemsof

galactoseintolerance,theLapplactasedeficiencyorglucose-galactosemalabsorption.

Linkedtoperindopril:

Cough:

Adrycoughhasbeenreportedwiththeuseofangiotensinconvertingenzymeinhibitors.Itischaracterisedbyits

persistenceandbyitsdisappearancewhentreatmentiswithdrawn.Aniatrogenicaetiologyshouldbeconsideredinthe

eventofthissymptom.Iftheprescriptionofanangiotensinconvertingenzymeinhibitorisstillpreferred,continuation

oftreatmentmaybeconsidered.

Childrenandadolescents:

Theefficacyandtolerabilityofperindoprilinchildrenandadolescents,aloneorincombination,havenotbeen

established.

Riskofarterialhypotensionand/orrenalinsufficiency(incasesofcardiacinsufficiency,waterandelectrolyte

depletion,etc.):

Markedstimulationoftherenin-angiotensin-aldosteronesystemhasbeenobservedparticularlyduringmarkedwater

andelectrolytedepletions(strictsodium-freedietorprolongeddiuretictreatment),inpatientswhosebloodpressurewas

initiallylow,incasesofrenalarterystenosis,congestiveheartfailureorcirrhosiswithoedemaandascites.

Theblockingofthissystemwithanangiotensinconvertingenzymeinhibitormaythereforecause,particularlyatthe

timeofthefirstadministrationandduringthefirsttwoweeksoftreatment,asuddendropinbloodpressureand/oran

increaseinplasmalevelsofcreatinine,showingafunctionalrenalinsufficiency.Occasionallythiscanbeacutein

onset,althoughrare,andwithavariabletimetoonset.

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 4

Elderly:

Renalfunctionandpotassiumlevelsshouldbetestedbeforethestartoftreatment.Theinitialdoseissubsequently

adjustedaccordingtobloodpressureresponse,especiallyincasesofwaterandelectrolytedepletion,inordertoavoid

suddenonsetofhypotension.

Patientswithknownatherosclerosis:

Theriskofhypotensionexistsinallpatientsbutparticularcareshouldbetakeninpatientswithischaemicheartdisease

orcerebralcirculatoryinsufficiency,withtreatmentbeingstartedatalowdose.

Renovascularhypertension:

Thetreatmentforrenovascularhypertensionisrevascularisation.Nonetheless,angiotensinconvertingenzyme

inhibitorscanbebeneficialinpatientspresentingwithrenovascularhypertensionwhoareawaitingcorrectivesurgery

orwhensuchasurgeryisnotpossible.

IfCOVERSYLARGININEPLUS5mg/1.25mgisprescribedtopatientswithknownorsuspectedrenalartery

stenosis,treatmentshouldbestartedinahospitalsettingatalowdoseandrenalfunctionandpotassiumlevelsshould

bemonitored,sincesomepatientshavedevelopedafunctionalrenalinsufficiencywhichwasreversedwhentreatment

wasstopped.

Otherpopulationsatrisk:

Inpatientswithseverecardiacinsufficiency(gradeIV)orinpatientswithinsulindependentdiabetesmellitus

(spontaneoustendencytoincreasedlevelsofpotassium),treatmentshouldbestartedundermedicalsupervisionwitha

reducedinitialdose.Treatmentwithbeta-blockersinhypertensivepatientswithcoronaryinsufficiencyshouldnotbe

stopped:theACEinhibitorshouldbeaddedtothebeta-blocker.

Diabeticpatients:

Theglycaemialevelsshouldbecloselymonitoredindiabeticpatientspreviouslytreatedwithoralantidiabeticdrugsor

insulin,namelyduringthefirstmonthoftreatmentwithanACEinhibitor.

Ethnicdifferences:

Aswithotherangiotensinconvertingenzymeinhibitors,perindoprilisapparentlylesseffectiveinloweringblood

pressureinblackpeoplethaninnon-blacks,possiblybecauseofahigherprevalenceoflow-reninstatesintheblack

hypertensivepopulation.

Surgery/anaesthesia::

Angiotensinconvertingenzymeinhibitorscancausehypotensionincasesofanaesthesia,especiallywhenthe

anaestheticadministeredisanagentwithhypotensivepotential.

Itisthereforerecommendedthattreatmentwithlong-actingangiotensinconvertingenzymeinhibitorssuchas

perindoprilshouldbediscontinuedwherepossibleonedaybeforesurgery.

Aorticormitralvalvestenosis/hypertrophiccardiomyopathy:

ACEinhibitorsshouldbeusedwithcautioninpatientwithanobstructionintheoutflowtractoftheleftventricle.

Hepaticfailure:

Rarely,ACEinhibitorshavebeenassociatedwithasyndromethatstartswithcholestaticjaundiceandprogressesto

fulminanthepaticnecrosisand(sometimes)death.Themechanismofthissyndromeisnotunderstood.Patients

receivingACEinhibitorswhodevelopjaundiceormarkedelevationsofhepaticenzymesshoulddiscontinuetheACE

inhibitorandreceiveappropriatemedicalfollow-up(seesection4.8).

Hyperkalaemia:

ElevationsinserumpotassiumhavebeenobservedinsomepatientstreatedwithACEinhibitors,includingperindopril.

Riskfactorsforthedevelopmentofhyperkalaemiaincludethosewithrenalinsufficiency,worseningofrenalfunction,

age(>70years),diabetesmellitus,intercurrentevents,inparticulardehydration,acutecardiacdecompensation,

metabolicacidosisandconcomitantuseofpotassium-sparingdiuretics(e.g.spironolactone,eplerenone,triamterene,or

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 5

associatedwithincreasesinserumpotassium(e.g.heparin).Theuseofpotassiumsupplements,potassium-sparing

diuretics,orpotassium-containingsaltsubstitutesparticularlyinpatientswithimpairedrenalfunctionmayleadtoa

significantincreaseinserumpotassium.Hyperkalemiacancauseserious,sometimesfatalarrhythmias.Ifconcomitant

useoftheabove-mentionedagentsisdeemedappropriate,theyshouldbeusedwithcautionandwithfrequent

monitoringofserumpotassium(seesection4.5).

Linkedtoindapamide:

Waterandelectrolytebalance:

Sodiumlevels:

Theseshouldbetestedbeforetreatmentisstarted,thenatregularintervals.Alldiuretictreatmentcancauseareduction

insodiumlevels,whichmayhaveseriousconsequences.Reductioninsodiumlevelscanbeinitiallyasymptomaticand

regulartestingisthereforeessential.Testingshouldbemorefrequentinelderlyandcirrhoticpatients(seesections4.8

and4.9).

Potassiumlevels:

Potassiumdepletionwithhypokalaemiaisamajorriskwiththiazidediureticsandthiazide-relateddiuretics.Theriskof

onsetofloweredpotassiumlevels(<3.4mmol/l)shouldbepreventedinsomehighriskpopulationssuchaselderly

and/ormalnourishedsubjects,whetherornottheyaretakingmultiplemedications,cirrhoticpatientswithoedemaand

ascites,coronarypatientsandpatientswithheartfailure.

Insuchcaseshypokalaemiaincreasesthecardiactoxicityofcardiacglycosidesandtheriskofrhythmdisorders.

SubjectspresentingwithalongQTintervalarealsoatrisk,whethertheoriginiscongenitaloriatrogenic.

Hypokalaemia,aswithbradycardia,actsasafactorwhichfavourstheonsetofsevererhythmdisorders,inparticular

torsadesdepointes,whichmaybefatal.

Inallcasesmorefrequenttestingofpotassiumlevelsisnecessary.Thefirstmeasurementofplasmapotassiumlevels

shouldbecarriedoutduringthefirstweekfollowingthestartoftreatment.

Iflowpotassiumlevelsaredetected,correctionisrequired.

Calciumlevels:

Thiazidediureticsandthiazide-relateddiureticsmayreduceurinaryexcretionofcalciumandcauseamildandtransient

increaseinplasmacalciumlevels.Markedlyraisedlevelsofcalciummayberelatedtoundiagnosed

hyperparathyroidism.Insuchcasesthetreatmentshouldbestoppedbeforeinvestigatingtheparathyroidfunction.

Bloodglucose:

Monitoringofbloodglucoseisimportantindiabeticpatients,particularlywhenpotassiumlevelsarelow.

Uricacid:

Tendencytogoutattacksmaybeincreasedinhyperuricaemicpatients.

Renalfunctionanddiuretics:

Thiazidediureticsandthiazide-relateddiureticsareonlyfullyeffectivewhenrenalfunctionisnormaloronlyslightly

impaired(creatininelevelslowerthanapproximately25mg/l,i.e.220µmol/lforanadult).

Intheelderlythevalueofplasmacreatininelevelsshouldbeadjustedtotakeaccountoftheage,weightandsexofthe

patient,accordingtotheCockroftformula:

clcr=(140-age)xbodyweight/0.814xplasmacreatininelevel

with:ageexpressedinyears

bodyweightinkg

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 6

Thisformulaissuitableforanelderlymaleandshouldbeadaptedforwomenbymultiplyingtheresultby0.85.

Hypovolaemia,resultingfromthelossofwaterandsodiumcausedbythediureticatthestartoftreatment,causesa

reductioninglomerularfiltration.Itmayresultinanincreaseinbloodureaandcreatininelevels.Thistransitory

functionalrenalinsufficiencyisofnoadverseconsequenceinpatientswithnormalrenalfunctionbutmayhowever

worsenapre-existingrenalimpairment.

Athletes:

Athletesshouldnotethatthisproductcontainsanactivesubstancewhichmaycauseapositivereactionindopingtests.

Lactose:

COVERSYLARGININEPLUS5mg/1.25mgFilm-coatedtabletscontainlactose.Patientswithrarehereditary

problemsofgalactoseintolerance,thelapplactasedeficiencyorglucose-galactosemalabsorptionshouldnottakethis

medicine.

4.5Interactionwithothermedicinalproductsandotherformsofinteraction

Commontoperindoprilandindapamide:

Concomitantusenotrecommended:

Lithium:reversibleincreasesinserumlithiumconcentrationsandtoxicityhavebeenreportedduringconcomitant

administrationoflithiumwithACEinhibitors.Concomitantuseofthiazidediureticsmayfurtherincreaselithium

levelsandenhancetheriskoflithiumtoxicitywithACEinhibitors.Useofperindoprilcombinedwithindapamidewith

lithiumisnotrecommended,butifthecombinationprovesnecessary,carefulmonitoringofserumlithiumlevels

shouldbeperformed(seesection4.4).

Concomitantusewhichrequiresspecialcare:

-Baclofen:Potentiationofantihypertensiveeffect.Monitoringofbloodpressureandrenalfunction,anddose

adaptationoftheantihypertensiveifnecessary.

-Non-steroidalanti-inflammatorymedicinalproducts(includedacetylsalicylicacidathighdoses):whenACE-

inhibitorsareadministeredsimultaneouslywithnon-steroidalanti-inflammatorydrugs(i.e.acetylsalicylicacidatanti-

inflammatorydosageregimens,COX-2inhibitorsandnon-selectiveNSAIDs),attenuationoftheantihypertensive

effectmayoccur.ConcomitantuseofACE-inhibitorsandNSAIDsmayleadtoanincreasedriskofworseningofrenal

function,includingpossibleacuterenalfailure,andanincreaseinserumpotassium,especiallyinpatientswithpoor

pre-existingrenalfunction.Thecombinationshouldbeadministeredwithcaution,especiallyintheelderly.Patients

shouldbeadequatelyhydratedandconsiderationshouldbegiventomonitoringrenalfunctionafterinitiationof

concomitanttherapy,andperiodicallythereafter.

Concomitantusewhichrequiressomecare:

-Imipramine-likeantidepressants(tricyclics),neuroleptics:Increasedantihypertensiveeffectandincreasedriskof

orthostatichypotension(additiveeffect).

-Corticosteroids,tetracosactide:Reductioninantihypertensiveeffect(saltandwaterretentionduetocorticosteroids).

-otherantihypertensiveagents:useofotherantihypertensivemedicinalproductswithperindopril/indapamidecould

resultinadditionalbloodpressureloweringeffect.

Linkedtoperindopril:

Concomitantusenotrecommended:

-Potassium-sparingdiuretics(spironolactone,triamterene,aloneorincombination),potassium(salts):ACEinhibitors

attenuatediureticinducedpotassiumloss.Potassiumsparingdiuretics,e.g.spironolactone,triamterene,oramiloride,

potassiumsupplements,orpotassium-containingsaltsubstitutesmayleadtosignificantincreasesinserumpotassium

(potentiallylethal).Ifconcomitantuseisindicatedbecauseofdocumentedhypokalemiatheyshouldbeusedwith

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 7

Concomitantusewhichrequiresspecialcare:

-Antidiabeticagents(insulin,hypoglycaemicsulphonamides):Reportedwithcaptoprilandenalapril.

Theuseofangiotensinconvertingenzymeinhibitorsmayincreasethehypoglycaemiceffectindiabeticsreceiving

treatmentwithinsulinorwithhypoglycaemicsulphonamides.Theonsetofhypoglycaemicepisodesisveryrare

(improvementinglucosetolerancewitharesultingreductionininsulinrequirements).

Concomitantusewhichrequiressomecare:

-Allopurinol,cytostaticorimmunosuppressiveagents,systemiccorticosteroidsorprocainamide:Concomitant

administrationwithACEinhibitorsmayleadtoanincreasedriskforleucopenia.

-Anaestheticdrugs:ACEinhibitorsmayenhancethehypotensiveeffectsofcertainanaestheticdrugs.

-Diuretics(thiazideorloopdiuretics):Priortreatmentwithhighdosediureticsmayresultinvolumedepletionandina

riskofhypotensionwheninitiatingtherapywithperindopril.

-Gold:Nitritoidreactions(symptomsincludefacialflushing,nausea,vomitingandhypotension)havebeenreported

rarelyinpatientsontherapywithinjectablegold(sodiumaurothiomalate)andconcomitantACEinhibitortherapy

includingperindopril.

Linkedtoindapamide:

Concomitantusewhichrequiresspecialcare:

-Torsadesdepointesinducingdrugs:Duetotheriskofhypokalemia,indapamideshouldbeadministeredwithcaution

whenassociatedwithmedicinalproductsthatinducedtorsadesdepointessuchasclassIAantiarrhythmicagents

(quinidine,hydroquinidine,disopyramide);classIIIantiarrhythmicagents(amiodarone,dofetilide,ibutilide,bretylium,

sotalol);someneuroleptics(chlorpromazine,cyamemazine,levomepromazine,thioridazine,trifluoperazine),

benzamides(amisulpride,sulpiride,tiapride),butyrophenones(droperidol,haloperidol),otherneuroleptics(pimozide);

othersubstancessuchasbepridil,cisapride,diphemanil,IVerythromycin,halofantrine,mizolastine,moxifloxacin,

pentamidine,sparfloxacin,IVvincamine,methadone,astemizole,terfenadine.Preventionoflowpotassiumlevelsand

correctionifnecessary:monitoringoftheQTinterval.

-Potassium-loweringdrugs:amphotericinB(IVroute),glucocorticoidsandmineralocorticoids(systemicroute),

tetracosactide,stimulantlaxatives:Increasedriskoflowpotassiumlevels(additiveeffect).Monitoringofpotassium

levels,andcorrectionifnecessary;particularconsiderationrequiredincasesoftreatmentwithcardiacglycosides.Non

stimulantlaxativesshouldbeused.

-Cardiacglycosides:Lowpotassiumlevelsfavourthetoxiceffectsofcardiacglycosides.PotassiumlevelsandECG

shouldbemonitoredandtreatmentreconsideredifnecessary.

Concomitantusewhichrequiressomecare:

-Metformin:Lacticacidosisduetometformincausedbypossiblefunctionalrenalinsufficiencylinkedtodiureticsand

inparticulartoloopdiuretics.Donotusemetforminwhenplasmacreatininelevelsexceed15mg/l(135micromol/l)in

menand12mg/l(110micromol/l)inwomen.

-Iodinatedcontrastmedia:Incasesofdehydrationcausedbydiuretics,thereisanincreasedriskofacuterenal

insufficiency,particularlywhenhighdosesofiodinatedcontrastmediaareused.Rehydrationshouldbecarriedout

beforetheiodinatedcompoundisadministered.

-Calcium(salts):Riskofincreasedlevelsofcalciumduetoreducedeliminationofcalciumintheurine.

-Ciclosporin:Riskofincreasedcreatininelevelswithnochangeincirculatinglevelsofciclosporin,evenwhenthereis

nosaltandwaterdepletion.

4.6Fertility,pregnancyandlactation

Pregnancy:

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 8

TheuseofACEinhibitorsisnotrecommendedduringthefirsttrimesterofpregnancy(seesection4.4).Theuse

ofACEinhibitorsiscontraindicatedduringthesecondandthirdtrimestersofpregnancy(seesection4.3and

4.4).

EpidemiologicalevidenceregardingtheriskofteratogenicityfollowingexposuretoACEinhibitorsduringthefirst

trimesterofpregnancyhasnotbeenconclusive;howeverasmallincreaseinriskcannotbeexcluded.Unlesscontinued

ACEinhibitortherapyisconsideredessential,patientsplanningpregnancyshouldbechangedtoalternativeanti-

hypertensivetreatmentswhichhaveanestablishedsafetyprofileforuseinpregnancy.Whenpregnancyisdiagnosed,

treatmentwithACEinhibitorsshouldbestoppedimmediately,and,ifappropriate,alternativetherapyshouldbestarted.

ExposuretoACEinhibitortherapyduringthesecondandthirdtrimestersisknowntoinducehumanfoetotoxicity

(decreasedrenalfunction,oligohydramnios,skullossificationretardation)andneonataltoxicity(renalfailure,

hypotension,hyperkalaemia)(seesection5.3).

ShouldexposuretoACEinhibitorshaveoccurredfromthesecondtrimesterofpregnancy,ultrasoundcheckofrenal

functionandskullisrecommended.

InfantswhosemothershavetakenACEinhibitorsshouldbecloselyobservedforhypotension(seesections4.3and

4.4).

Linkedtoindapamide:

Prolongedexposuretothiazideduringthethirdtrimesterofpregnancycanreducematernalplasmavolumeaswellas

uteroplacentalbloodflow,whichmaycauseafeto-placentalischemiaandgrowthretardation.Moreover,rarecasesof

hypoglycemiaandthrombocytopeniainneonateshavebeenreportedfollowingexposurenearterm.

Lactation:

COVERSYLARGININEPLUS5mg/1.25mgiscontraindicatedduringlactation.

Useofperindoprilisnotrecommendedduringbreastfeeding

Indapamideisexcretedinhumanmilk.Indapamideiscloselyrelatedtothiazidediureticswhichhavebeenassociated,

duringbreast-feeding,withdecreaseorevensuppressionofmilklactation.Hypersensitivitytosulfonamide-derived

drugs,hypokalaemiaandnuclearicterusmightoccur.

As,withbothdrugs,seriousadversereactionsmightoccurinnursinginfants,adecisionshouldbemadewhetherto

discontinuenursingortodiscontinuetherapytakingaccounttheimportanceofthistherapyforthemother.

4.7Effectsonabilitytodriveandusemachines

Linkedtoperindopril,indapamideandCOVERSYLARGININEPLUS5mg/1.25mg:

NeitherthetwoactivesubstancesnorCOVERSYLARGININEPLUS5mg/1.25mgaffectalertnessbutindividualreactions

relatedtolowbloodpressuremayoccurinsomepatients,particularlyatthestartoftreatmentorincombinationwithanother

antihypertensivemedication.

Asaresulttheabilitytodriveoroperatemachinerymaybeimpaired.

4.8Undesirableeffects

Theadministrationofperindoprilinhibitstherenin-angiotensin-aldosteroneaxisandtendstoreducethepotassiumloss

causedbyindapamide.FourpercentofthepatientsontreatmentwithCOVERSYLARGININEPLUS5mg/1.25mg

experiencehypokalaemia(potassiumlevel<3.4mmol/l).

Thefollowingundesirableeffectscouldbeobservedduringtreatmentandrankedunderthefollowingfrequency:

Verycommon( ≥1/10);common(≥1/100,<1/10);uncommon(≥1/1000,<1/100);rare(≥1/10000,<1/1000),veryrare

(<1/10000),notknown(cannotbeestimatedfromtheavailabledata).

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 9

Veryrare:

-Thrombocytopenia,leucopenia/neutopenia,agranulocytosis,aplasticanaemia,haemolyticanaemia.

-Anaemia(seesection4.4)hasbeenreportedwithangiotensinconvertingenzymeinhibitorsinspecificcircumstances

(patientswhohavehadkidneytransplants,patientsundergoinghaemodialysis).

Psychiatricdisorders:

Uncommon:moodorsleepdisturbances.

Nervoussystemdisorders:

Common:Paresthesia,headache,asthenia,feelingsofdizziness,vertigo.

Veryrare:Confusion.

Eyedisorders:

Common:Visiondisturbance.

Earandlabyrinthdisorders:

Common:Tinnitus.

Vasculardisorders:

Common:Hypotensionwhetherorthostaticornot(seesection4.4).

Cardiacdisorders:

Veryrare:Arrhythmiaincludingbradycardia,ventriculartachycardia,atrialfibrillation,anginapectorisandmyocardial

infarctionpossiblysecondarytoexcessivehypotensioninhigh-riskpatients(seesection4.4).

Respiratory,thoracicandmediastinaldisorders:

Common:

-Adrycoughhasbeenreportedwiththeuseofangiotensinconvertingenzymeinhibitors.Itischaracterisedbyits

persistenceandbyitsdisappearancewhentreatmentiswithdrawn.Aniatrogenicaetiologyshouldbeconsideredinthe

presenceofthissymptom.Dyspnoea.

Uncommon:Bronchospasm.

Veryrare:Eosinophilicpneumonia,rhinitis.

Gastrointestinaldisorders:

Common:Constipation,drymouth,nausea,epigastricpain,anorexia,vomiting,abdominalpains,tastedisturbance,

dyspepsia,diarrhoea.

Veryrare:Pancreatitis

Hepato-biliarydisorders:

Veryrare:Hepatitiseithercytolyticorcholestatic(seesection4.4).

Notknown:Incaseofhepaticinsufficiency,thereisapossibilityofonsetofhepaticencephalopathy(seesections4.3

and4.4).

Skinandsubcutaneoustissuedisorders:

Common:Rash,pruritus,maculopapulareruptions.

Uncommon:

-Angioedemaofface,extremities,lips,mucousmembranes,tongue,glottisand/orlarynx,urticaria(seesection4.4)

-Hypersensitivityreactions,mainlydermatological,insubjectswithapredispositiontoallergicandasthmatic

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 10

-Purpura

Possibleaggravationofpre-existingacutedisseminatedlupuserythematosus

Veryrare:erythemamultiforme,toxicepidermicnecrolysis,StevenJohnsonsyndrome.

Casesofphotosensitivityreactionshavebeenreported(seesection4.4).

Musculoskeletal,connectivetissueandbonedisorders:

Common:Cramps.

Renalandurinarydisorders:

Uncommon:Renalinsufficiency.

Veryrare:Acuterenalfailure.

Reproductivesystemandbreastdisorders:

Uncommon:Impotence.

Generaldisordersandadministrationsiteconditions:

Common:Asthenia.

Uncommon:Sweating.

Investigations:

-Potassiumdepletionwithparticularlyseriousreductioninlevelsofpotassiuminsomeatriskpopulations(seesection

4.4).

-Reducedsodiumlevelswithhypovolaemiacausingdehydrationandorthostatichypotension.

-Increaseinuricacidlevelsandinbloodglucoselevelsduringtreatment.

-Slightincreaseinureaandinplasmacreatininelevels,reversiblewhentreatmentisstopped.Thisincreaseismore

frequentincasesofrenalarterystenosis,arterialhypertensiontreatedwithdiuretics,renalinsufficiency.

-Increasedlevelsofpotassium,usuallytransitory.

Rare:Raisedplasmacalciumlevels.

4.9Overdose

Themostlikelyadversereactionincasesofoverdoseishypotension,sometimesassociatedwithnausea,vomiting,cramps,

dizziness,sleepiness,mentalconfusion,oliguriawhichmayprogresstoanuria(duetohypovolaemia).Saltandwaterdisturbances

(lowsodiumlevels,lowpotassiumlevels)mayoccur.

Thefirstmeasurestobetakenconsistofrapidlyeliminatingtheproduct(s)ingestedbygastriclavageand/oradministrationof

activatedcharcoal,thenrestoringfluidandelectrolytebalanceinaspecialisedcentreuntiltheyreturntonormal.

Ifmarkedhypotensionoccurs,thiscanbetreatedbyplacingthepatientinasupinepositionwiththeheadlowered.Ifnecessaryan

intravenousinfusionofisotonicsalinemaybegiven,oranyothermethodofvolaemicexpansionmaybeused.

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 11

5PHARMACOLOGICALPROPERTIES

5.1Pharmacodynamicproperties

Pharmacotherapeuticgroup:perindoprilanddiuretics,ATCcode:C09BA04

COVERSYLARGININEPLUS5mg/1.25mgisacombinationofperindoprilargininesalt,anangiotensinconverting

enzymeinhibitor,andindapamide,achlorosulphamoyldiuretic.Itspharmacologicalpropertiesarederivedfromthose

ofeachofthecomponentstakenseparately,inadditiontothoseduetotheadditivesynergicactionofthetwoproducts

whencombined.

Pharmacologicalmechanismofaction

LinkedtoCOVERSYLARGININEPLUS5mg/1.25mg:

COVERSYLARGININEPLUS5mg/1.25mgproducesanadditivesynergyoftheantihypertensiveeffectsofthetwo

components.

Linkedtoperindopril:

Perindoprilisaninhibitoroftheangiotensinconvertingenzyme(ACEinhibitor)whichconvertsangiotensinIto

angiotensinII,avasoconstrictingsubstance;inadditiontheenzymestimulatesthesecretionofaldosteronebythe

adrenalcortexandstimulatesthedegradationofbradykinin,avasodilatorysubstance,intoinactiveheptapeptides.

Thisresultsin:

-areductioninaldosteronesecretion,

-anincreaseinplasmareninactivity,sincealdosteronenolongerexercisesnegativefeedback,

-areductionintotalperipheralresistancewithapreferentialactiononthevascularbedinmuscleandthekidney,with

noaccompanyingsaltandwaterretentionorreflextachycardia,withchronictreatment.

Theantihypertensiveactionofperindoprilalsooccursinpatientswithlowornormalreninconcentrations.

Perindoprilactsthroughitsactivemetabolite,perindoprilat.Theothermetabolitesareinactive.

Perindoprilreducestheworkoftheheart:

-byavasodilatoryeffectonveins,probablycausedbychangesinthemetabolismofprostaglandins:reductioninpre-

load,

-byreductionofthetotalperipheralresistance:reductioninafterload.

Studiescarriedoutonpatientswithcardiacinsufficiencyhaveshown:

-areductioninleftandrightventricularfillingpressures,

-areductionintotalperipheralvascularresistance,

-anincreaseincardiacoutputandanimprovementinthecardiacindex,

-anincreaseinregionalbloodflowinmuscle.

Exercisetestresultsalsoshowedimprovement.

Linkedtoindapamide:

Indapamideisasulphonamidederivativewithanindolering,pharmacologicallyrelatedtothethiazidegroupof

diuretics.Indapamideinhibitsthereabsorptionofsodiuminthecorticaldilutionsegment.Itincreasestheurinary

excretionofsodiumandchloridesand,toalesserextent,theexcretionofpotassiumandmagnesium,therebyincreasing

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 12

Characteristicsofantihypertensiveaction

LinkedtoCOVERSYLARGININEPLUS5mg/1.25mg:

Inhypertensivepatientsregardlessofage,COVERSYLARGININEPLUS5mg/1.25mgexertsadose-dependent

antihypertensiveeffectondiastolicandsystolicarterialpressurewhilstsupineorstanding.Thisantihypertensiveeffect

lastsfor24hours.Thereductioninbloodpressureisobtainedinlessthanonemonthwithouttachyphylaxis;stopping

treatmenthasnoreboundeffect.Duringclinicaltrials,theconcomitantadministrationofperindoprilandindapamide

producedantihypertensiveeffectsofasynergicnatureinrelationtoeachoftheproductsadministeredalone.

PICXEL,amulticenter,randomised,doubleblindactivecontrolledstudyhasassessedonechocardiographytheeffect

ofperindopril/indapamidecombinationonLVHversusenalaprilmonotherapy.

InPICXEL,hypertensivepatientswithLVH(definedasleftventricularmassindex(LVMI)>120g/m 2

inmaleand>

100g/m 2

infemale)wererandomisedeithertoperindopriltert-butylamine2mg(equivalentto2.5mgperindopril

arginine)/indapamide0.625mgortoenalapril10mgonceadayforaone-yeartreatment.Thedosewasadapted

accordingtobloodpressurecontrol,uptoperindopriltert-butylamine8mg(equivalentto10mgperindoprilarginine)

andindapamide2.5mgorenalapril40mgonceaday.Only34%ofthesubjectsremainedtreatedwithperindopriltert-

butylamine2mg(equivalentto2.5mgperindoprilarginine)/indapamide0.625mg(versus20%withEnalapril10mg).

Attheendoftreatment,LVMIhaddecreasedsignificantlymoreintheperindopril/indapamidegroup(-10.1g/m²)than

intheenalaprilgroup(-1.1g/m²)intheallrandomisedpatientspopulation.ThebetweengroupdifferenceinLVMI

changewas-8.3(95%CI(-11.5,-5.0),p<0.0001).

AbettereffectonLVMIwasreachedwithhigherperindopril/indapamidedosesthanthoselicensedforPRETERAX

ARGININE2.5mg/0.625mgandCOVERSYLARGININEPLUS5mg/1.25mg.

Regardingbloodpressure,theestimatedmeanbetween-groupdifferencesintherandomisedpopulationwere-

5.8mmHg(95%CI(-7.9,-3.7),p<0.0001)forsystolicbloodpressureand-2.3mmHg(95%CI(-3.6,-0.9),p=0.0004)

fordiastolicbloodpressurerespectively,infavouroftheperindopril/indapamidegroup.

Linkedtoperindopril:

Perindoprilisactiveinallgradesofhypertension:mildtomoderateorsevere.Areductioninsystolicanddiastolic

arterialpressureisobservedinthelyingandstandingposition.

Theantihypertensiveactivityafterasingledoseismaximalatbetween4and6hoursandismaintainedover24hours.

Thereisahighdegreeofresidualblockingofangiotensinconvertingenzymeat24hours,approximately80%.

Inpatientswhorespond,normalisedbloodpressureisreachedafteronemonthandismaintainedwithout

tachyphylaxis.

Withdrawaloftreatmenthasnoreboundeffectonhypertension.

Perindoprilhasvasodilatorypropertiesandrestoreselasticityofthemainarterialtrunks,correctshistomorphometric

changesinresistancearteriesandproducesareductioninleftventricularhypertrophy.

Ifnecessary,theadditionofathiazidediureticleadstoanadditivesynergy.

Thecombinationofanangiotensinconvertingenzymeinhibitorwithathiazidediureticdecreasesthehypokalaemia

riskassociatedwiththediureticalone.

Linkedtoindapamide:

Indapamide,asmonotherapy,hasanantihypertensiveeffectwhichlastsfor24hours.Thiseffectoccursatdosesat

whichthediureticpropertiesareminimal.

Itsantihypertensiveactionisproportionaltoanimprovementinarterialcomplianceandareductionintotaland

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 13

Indapamidereducesleftventricularhypertrophy.

Whenadoseofthiazidediureticandthiazide-relateddiureticsisexceeded,theantihypertensiveeffectreachesa

plateau,whereastheadverseeffectscontinuetoincrease.Ifthetreatmentisineffective,thedoseshouldnotbe

increased.

Furthermore,ithasbeenshownthatintheshort-term,mid-termandlong-terminhypertensivepatients,indapamide:

-hasnoeffectonlipidmetabolism:triglycerides,LDL-cholesterolandHDL-cholesterol,

-hasnoeffectoncarbohydratemetabolism,evenindiabetichypertensivepatients.

5.2Pharmacokineticproperties

LinkedtoCOVERSYLARGININEPLUS5mg/1.25mg:

Theco-administrationofperindoprilandindapamidedoesnotchangetheirpharmacokineticpropertiesbycomparisontoseparate

administration.

Linkedtoperindopril:

Afteroraladministration,theabsorptionofperindoprilisrapidandthepeakconcentrationisachievedwithin1hour.Theplasma

half-lifeofperindoprilisequalto1hour.

Perindoprilisaprodrug.Twentysevenpercentoftheadministeredperindoprildosereachesthebloodstreamastheactive

metaboliteperindoprilat.Inadditiontoactiveperindoprilat,perindoprilyieldsfivemetabolites,allinactive.Thepeakplasma

concentrationofperindoprilatisachievedwithin3to4hours.

Asingestionoffooddecreasesconversiontoperindoprilat,hencebioavailability,perindoprilarginineshouldbeadministered

orallyinasingledailydoseinthemorningbeforeameal.

Ithasbeendemonstratedalinearrelationshipbetweenthedoseofperindoprilanditsplasmaexposure.

Thevolumeofdistributionisapproximately0.2l/kgforunboundperindoprilat.Proteinbindingofperindoprilattoplasmaproteins

is20%,principallytoangiotensinconvertingenzyme,butisconcentration-dependent.

Perindoprilatiseliminatedintheurineandtheterminalhalf-lifeoftheunboundfractionisapproximately17hours,resultingin

steady-statewithin4days.

Eliminationofperindoprilatisdecreasedintheelderly,andalsoinpatientswithheartorrenalfailure.Dosageadjustmentinrenal

insufficiencyisdesirabledependingonthedegreeofimpairment(creatinineclearance).

Dialysisclearanceofperindoprilatisequalto70ml/min.

Perindoprilkineticsaremodifiedinpatientswithcirrhosis:hepaticclearanceoftheparentmoleculeisreducedbyhalf.However,

thequantityofperindoprilatformedisnotreducedandthereforenodosageadjustmentisrequired(seesections4.2and4.4).

Linkedtoindapamide:

Indapamideisrapidlyandcompletelyabsorbedfromthedigestivetract.

Thepeakplasmalevelisreachedinhumansapproximatelyonehourafteroraladministrationoftheproduct.Plasmaprotein

bindingis79%.

Theeliminationhalf-lifeisbetween14and24hours(average18hours).Repeatedadministrationdoesnotproduceaccumulation.

Eliminationismainlyintheurine(70%ofthedose)andfaeces(22%)intheformofinactivemetabolites.

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 14

5.3Preclinicalsafetydata

COVERSYLARGININEPLUS5mg/1.25mghasslightlyincreasedtoxicitythanthatofitscomponents.Renalmanifestationsdo

notseemtobepotentiatedintherat.However,thecombinationproducesgastro-intestinaltoxicityinthedogandthetoxiceffects

onthemotherseemtobeincreasedintherat(comparedtoperindopril).

Nonetheless,theseadverseeffectsareshownatdoselevelscorrespondingtoaverymarkedsafetymarginbycomparisontothe

therapeuticdosesused.

Preclinicalstudiesperformedseparatelywithperindoprilandindapamidedidnotshowgenotoxic,carcinogenicorteratogenic

potential.

6PHARMACEUTICALPARTICULARS

6.1Listofexcipients

Core:

Lactosemonohydrate

Magnesiumstearate(E470B)

Maltodextrin

Silicacolloidalanhydrous(E551)

Sodiumstarchglycolate(typeA)

Film-coating:

Glycerol(E422)

Hypromellose(E464)

Macrogol6000

Magnesiumstearate(E470B)

Titaniumdioxide(E171)

6.2Incompatibilities

Notapplicable.

6.3Shelflife

Theshelflifeexpirydateofthisproductshallbethedateshownonthecontainerandouterpackageoftheproductonthemarket

inthecountryoforigin.

6.4Specialprecautionsforstorage

Keepthecontainertightlyclosedinordertoprotectfrommoisture.

6.5Natureandcontentsofcontainer

ProductimportedfromtheUKandPoland:

Whitetabletcontainerwithaflowreducerandblueopaquestoppercontainingadessicantgel.

PackSize:30tablets

ProductimportedfromHungary:

Whitetabletcontainerwithaflowreducerandwhiteopaquestoppercontainingadessicantgel.

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 15

6.6Specialprecautionsfordisposalofausedmedicinalproductorwastematerialsderivedfrom

suchmedicinalproductandotherhandlingoftheproduct

Nospecialrequirements.

7PARALLELPRODUCTAUTHORISATIONHOLDER

ImbatLimited

UnitL2

NorthRingBusinessPark

Santry

Dublin9

8PARALLELPRODUCTAUTHORISATIONNUMBER

PPA1151/85/1

9DATEOFFIRSTAUTHORISATION/RENEWALOFTHEAUTHORISATION

DateofFirstAuthorisation:14 th

November2008

10DATEOFREVISIONOFTHETEXT

Irish Medicines Board

______________________________________________________________________________________________________________________

Date Printed 19/07/2011 CRN 2103007 page number: 16