ANASTROL

Israel - English - Ministry of Health

Buy It Now

Active ingredient:
ANASTROZOLE 1 MG
Available from:
PERRIGO ISRAEL AGENCIES LTD
ATC code:
L02BG03
Pharmaceutical form:
FILM COATED TABLETS
Administration route:
PER OS
Manufactured by:
HAUPT PHARMA MUNSTER GmbH, GERMANY
Therapeutic group:
ANASTROZOLE
Therapeutic indications:
Treatment of advanced breast cancer in post menopausal women. Efficay has not been demonstrated in estrogen receptor negative patients unless they had a previous positive clinical response to tamoxifen. Adjuvant treatment of postmenopausal women with hormone receptor positive early invasive breast cancer. Adjuvant treatment of early breast cancer in hormone receptor positive postmenopausal women who have received 2 to 3 years of adjuvant tamoxifen.
Authorization number:
145803306000
Authorization date:
2011-04-01

Documents in other languages

Patient Information leaflet Patient Information leaflet - Arabic

25-01-2021

Patient Information leaflet Patient Information leaflet - Hebrew

25-01-2021

1986- ו"משתה )םירישכת( םיחקורה תונקת יפל תינכרצל ןולע

אפור םשרמב תבייח וז הפורת

הפורתב ישמתשת םרטב ופוס דע ןולעה תא ןויעב יארק

2011לירפאבודי-לערשואוקדבנונכותותואירבהדרשמי"עעבקנהזןולעטמרופ

לורטסנא

תוילבט

:בכרה

Anastrozole 1 mg :הליכמ הילבט לכ

:םיליעפ יתלב םירמוח

Lactosemonohydrate,sodiumstarchglycolate,povidoneK25,magnesium

stearate,hypromellose,macrogol6000,hydrogenatedcottonseedoil,maize

starch, titanium dioxide.

.זוטקל ג"מ92.750:הליכמ הילבט לכ

.ןרתנ ג"מ0.126

.זאטמורא םיזנא יבכעמ:תיטיופרת הצובק

:תיאופר תוליעפ

.תולבה ליג רחאל םישנב דשה ןטרסב לופיטל

?הפורתב שמתשהל ןיא יתמ

.תולבה ליג ינפל וא הקינימ ,ןוירהב ךניה רשאכ הפורתב ישמתשת לא

םינגורטסאתוליכמהתופורתואןפיסקומטםעתינמז-ובוזהפורתבשמתשהלןיא

העפשהבהתחפהלששחמ,יפולחילנומרוהלופיטבלשמלומכ)םיישנםינומרוה(

.)"תויתפורת-ןיב תובוגת" :ףיעסב םג יאר( לוזורטסנא לש

יוקילמואתוילכהדוקפתברומחיוקילמתלבוסךניהםאהפורתבשמתשהלןיא

.דבכה דוקפתב רומח דע ינוניב

.הפורתה יביכרממ דחאל תושיגר ךל העודי םא שמתשהל ןיא

.םידליל דעוימ וניא רישכתה

םירקמבלופיטהתלחתהינפלאפורבץעוויהלילבמהפורתבשמתשהלןיא

:םיאבה

,תוילכהואדבכהלעתועיפשמהתולחממואיוקילמרבעבתלבסואתלבוסךניהםא

םא,)סיזורופואיטסוא(תומצעהקזוחלעעיפשמהוהשלכבצממתלבוסךניהםא

תויעבב,דשהןטרסבלופיטלתופורת( LHRH תצובקלתוכיישהתופורתתלטונךניה

אללתופורתתוברלןהשלכתורחאתופורתוא)תוירופ-יאב,תומיוסמתויגולוקניג

.תשכרש םשרמ

.זוטקלל תושיגר ךל העודי םא

?ךלש םוי םויה ייח לע הפורתה עיפשת ךיא

תולוחןנשי.תונוכמתלעפהתלוכיבואתונריעבםוגפלהרומאהניאוזהפורת

הגיהנמענמיהלשיהלאםירקמב-תוינונשיואהשלוחשיגרהלתולולעםיתיעלש

.תונוכמ תלעפהמ וא

:תורהזא

לורטסנאתלטונךניהשיאופרהתווצהתאעדיילךיילעםילוח-תיבלהעגהלשהרקמב

.תוילבט

הלוכתהןדבואלםורגללולעהזבצמוםיישנהםינומרוההתמרתאתיחפמלורטסנא

אפורביצעוויה.םירבשלןוכיסבהיילעלךכבקעוןקזוחתתחפהל,תומצעהלשתילרנימה

.לופיטה תויורשפאו ןוכיסה יבגל

ינפלאפורלךכ-לעעידוהלךיילע,יהשלכהפורתלואוהשלכןוזמלהשיגרךניהםא

.הפורתה תליטנ

תלבוסךניהשאפורידי-לעךלרמאנםא.רכוסלשגוסוניהש,זוטקלליכמלורטסנא

ןכומכ.לורטסנאתליטנינפלאפורבץעוויהלשי,םימיוסמםירכוסלתוליבסיאמ

םורגלםילולערשא, titaniumdioxide , sodiumstarchglycolate תוליכמתוילבטה

.ולא םירמוחל םישיגרה םישנא לש ןטק רפסמב תויעבל

.דבלב אפורה תארוהב אלא לופיטה תא קיספהל ןיא

:תויתפורת-ןיב תובוגת

,הנוזתיפסותוםשרמאללתורכמנהתופורתללוכ,תפסונהפורתתלטונךניהםא

עונמלידכלפטמהאפורלחוודלךיילע,תרחאהפורתבלופיטהתעהזתרמגםאוא

.תויתפורת-ןיב תובוגתמ םיעבונה תוליעי-יא וא םינוכיס

םינומרוהןוגכ(ןגורטסאתוליכמהתופורתתלטונךניהםאלורטסנאתוילבטלוטילןיא

תויעבב,דשהןטרסבלופיטלתופורת( LHRH תצובקמםיילנומרוהםירישכת,)םייפולח

."?הפורתב שמתשהל ןיא יתמ" :ףיעסב םג יאר .)תוירופ-יאב ,תומיוסמ תויגולוקניג

:יאוול תועפות

,יאוולתועפותעיפוהלתולולעהבשומישהןמזב,הפורתהלשהיוצרהתוליעפלףסונב

,תוהובגלורטסלוכתומר,ןובאיתרסוח,םינתשמחוריבצמ,ילוחתשוחת,קיתרנבשבוי

לשהרקמב-)לופיטלםינושארהתועובשבללכךרדב(ילניגאוםומיד,תואקה,תוינונשי

דיהףכתרהנמתנומסת,אפורלםדקהבחוודלשיךשמתמועודיאלילניגאוםומיד

םיקלחבהשלוחורוקתשוחת,באכ,ץוצקעתשוחתבתאטבתמה)תילפרקהרהנמ(

.דיה ףכ לש

יכרעבםייונישעיפוהלםילולע,לורטסנאבלופיטהךלהמבםדתוקידבעוציבתעב

.לורטסלוכה תמרו דבכה ידוקפת

:תדחוימ תוסחייתה תובייחמה יאוול תועפות

תוחפנתהל,תרוחרחסלואהמישנבםיישקלםורגלתולולעשתורומחתויגרלאתובוגת

דואמתורומחרועתובוגת;העילב/המישנבתויעבלוןורגהואןושלה,םייתפשה,םינפה

!דימ אפורל תונפל שי - תויחופלש וא םיביכ ,תורובחב תוולמה

.)תולוח10,000-ל1-מ תוחפ לש סחי( רתויב תורידנ הלא תובוגת

וארועהתבהצה(תבהצילבואםעהערתיללכהשגרה:הינימסתשדבכבהעיגפ

.אפורל תידיימ תונפל שי - ןובאית ןדבוא ,ההכ ןתש ,)םייניעה

יונישלחםאוא,הזןולעבוניוצאלשיאוולתועפותהשיגרמךניהובשהרקמלכב

.דימ אפורה םע ץעייתהל ךיילע ,תיללכה ךתשגרהב

:ןונימ

.םויב תחא הילבט

.דבלב אפורה תוארוה יפל ןונימ

.תצלמומה הנמה לע רובעל ןיא

.םידליל תדעוימ הניא וז הפורת

.לפטמה אפורה ידי-לע עבקנש יפכ םיבוצק םינמזב וז הפורתב שמתשהל שי

םינמזהחוליפלהאבההנמהתאלוטילשיבוצקןמזבוזהפורתלוטילתחכשםא

.ליגרהו בוצקה

תשגלואאפורהםערשקדימרוצילךיילע,ךלשליגרהןונימלרבעמתועטבתלטנםא

.בורק םילוח-תיבל

:שומישה ןפוא

.םימ םע הילבטה תא עולבל שי !סועלל ןיא

.לכוא ילב וא םע הילבטה תא לוטיל ןתינ

?לופיטה תחלצהל עייסל ילכות דציכ

.אפורה ידי-לע ץלמוהש לופיטה תא םילשהל ךיילע

.הפורתב שומיש לש םינש רפסמ ושרדייש ןכתיי .חווט ךורא וניה לופיטה

תוצעייתהאללהפורתבלופיטהתאקיספהלןיאךתואירבבצמברופישלחםאםג

.אפור םע

!הלערה יענמ

וא/וםידלילשםדיגשיהלץוחמרוגסםוקמברומשלשיתרחאהפורתלכווזהפורת

.הלערה יענמת ךכ ידי-לעו תוקונית

-תיבלשןוימרדחלדימינפ,הפורתהןמדליעלבתועטבםאוארתיתנמתלטנםא

.ךתיא הפורתה תזירא יאיבהו םילוח

!אפורמ תשרופמ הארוה אללהאקהל םורגל ןיא

הפורתינתיתלא.קיזהלהלולעאיהתרחאהלוחב,ךתלחמבלופיטלהמשרנוזהפורת

.ךיירכמ וא ךיינכש ,ךייבורקל וז

.הפורתתלטונךניהשםעפלכבהנמהותיוותהתאיקדב!ךשוחבתופורתלוטילןיא

.םהל הקוקז ךניה םא םייפקשמ יביכרה

-ל תחתמ:הנסחא

.דבלבתלבגומהפוקתלתורמשנתופורת,םיצלמומההנסחאה/הזיראהיאנתיפלםג

חקורבץעוויהלךיילע,קפסלשהרקמלכב!רישכתהלשהגופתהךיראתלבלםישלאנ

.הפורתה תא ךל קפיסש

.הזירא התואב תונוש תופורת ןסחאל ןיא

14580.33060:הפורתה םושיר 'סמ

:ןרצי

.הטלמ ,ראפ לאה ,מ"עב )הטלמ( סקירנ'ג דירפגיס

:םושירה לעב

.51200קרב-ינב ,29י"חל 'חר ,מ"עב תויונכוס לארשי וגירפ

10.4.11

60270

PATIENT PACKAGE INSERT IN ACCORDANCE WITH

THE PHARMACISTS' REGULATIONS (PREPARATIONS) - 1986

The dispensing of this medicine requires a doctor's prescription

Read this package insert carefully in its entirety before using this medicine

The format of this leaflet was determined by the Ministry of Health

and its content was checked and approved by it in April 2011

ANASTROL

Tablets

Composition:

Each tablet contains: Anastrozole 1 mg

Inactive ingredients:

Lactosemonohydrate,sodiumstarchglycolate,povidoneK25,magnesiumstearate,

hypromellose,macrogol6000,hydrogenatedcottonseedoil,maizestarch,titanium

dioxide.

Each tablet contains: 92.750 mg lactose.

0.126 mg sodium.

Therapeutic group:Aromatase inhibitors.

Therapeutic activity:

Treatment of breast cancer in post-menopausal women.

When should the medicine not be used?

Do not use this medicine if you are pregnant, breastfeeding or pre-menopausal.

Donotusethismedicineconcomitantlywithtamoxifenormedicinescontaining

oestrogens(femalehormones),forexample,hormonereplacementtherapy,asit

may lessen the effect of anastrozole (see also “Drug Interactions” section).

Donotusethismedicineifyousufferfromaseverekidneyfunctionimpairment

or mild to severe liver function impairment.

Donotusethismedicineifyouhaveaknownsensitivitytoanyofitsingredients.

The preparation is not intended for children.

Donottakethismedicinewithoutconsultingadoctorbeforestarting

treatment in the following cases:

Ifyouaresuffering,orhavesufferedinthepast,fromanimpairmentordiseasesthat

affecttheliverorkidneys,ifyouaresufferingfromanyconditionthataffectsbone

strength(osteoporosis),ifyouaretakingmedicinesbelongingtotheLHRHgroup

(medicinesfortreatmentofbreastcancer,certaingynaecologicalproblems,infertility)

or any other medicines including non-prescription medicines that you purchased.

If you have a known sensitivity to lactose.

How will this medicine affect your daily life?

Thismedicineisunlikelytoimpairalertnessortheabilitytooperatemachinery.

Somepatientsmayoccasionallyfeelweakorsleepy-inthesecasesavoiddriving

or operating machinery.

Warnings:

Incaseyougointoahospital,youmustinformthemedicalstaffthatyouaretaking

Anastroltablets.

Anastrollowerstheleveloffemalehormones,whichmayleadtoalossofthemineral

contentofthebones,reductionoftheirstrengthandconsequently,anincreasedrisk

of fractures. Consult the doctor about this risk and treatment possibilities.

Ifyouaresensitivetoanytypeoffoodormedicine,informyourdoctorbefore

commencing treatment with this medicine.

Anastrolcontainslactose,whichisatypeofsugar.Ifyouhavebeentoldbyadoctor

thatyouareintoleranttocertainsugars,consultthedoctorbeforetakingAnastrol.

Thetabletsalsocontainsodiumstarchglycolate,titaniumdioxide,whichmaycause

problems in a small number of people who are sensitive to these substances.

Do not stop treatment unless explicitly instructed to do so by the doctor.

Drug interactions:

Ifyouaretakinganotherdrug,includingnon-prescriptionmedicinesandfood

supplements,orifyouhavejustfinishedtreatmentwithanothermedicine,inform

theattendingdoctor,inordertopreventhazardsorlackofefficacyarisingfrom

drug interactions.

DonottakeAnastroltabletsifyouaretakingmedicinescontainingoestrogen(e.g.,

hormonereplacements),hormonalpreparationsfromtheLHRHgroup(medicines

fortreatmentofbreastcancer,certaingynaecologicalproblems,infertility).Seealso

“When should the preparation not be used?” section.

Side effects:

Inadditiontothedesiredeffectofthemedicine,adversereactionsmayoccurduring

thecourseoftakingthismedicine,forexample:hotflushes,headache,nausea,

diarrhoea,rash,thinningofthehair,jointstiffnessandpain,vaginaldryness,feeling

sick,moodchanges,lackofappetite,highcholesterollevels,sleepiness,vomiting,

vaginalbleeding(usuallyinthefirstfewweeksoftreatment)-shouldunexplained

syndromemanifestedbytinglingsensation,pain,coldnessandweaknessinparts

of the hand.

Changesinliverfunctionvaluesandcholesterollevelinbloodtestsperformedduring

treatment withAnastrolmay be observed.

Side effects that require special attention:

Severeallergicreactionswhichmaycausedifficultybreathingordizziness,swellingof

theface,lips,tongueorthroatandbreathing/swallowingproblems;verysevereskin

reactions with bruises, ulcers or blisters - contact the doctor immediately!

These reactions are very rare (a ratio of less than 1 to 10,000 patients).

Liverdamage,thesymptomsofwhichare:feelinggenerallyunwellwithorwithout

jaundice(yellowingoftheskinoreyes),darkurine,lossofappetite-contactthe

doctor immediately.

Intheeventthatyouexperiencesideeffectsnotmentionedinthisleaflet,orifthere

is a change in your general health, consult your doctor immediately.

Dosage:

One tablet daily.

Dosage is according to doctor's instructions only.

Do not exceed the recommended dose.

This medicine is not intended for children.

Thismedicineistobetakenatspecifictimeintervalsasdeterminedbytheattending

doctor.

Ifyouforgettotakethismedicineatthespecifiedtime,takethenextdoseaccording

to the fixed and regular schedule.

Ifyouaccidentallytakemorethanyournormaldose,proceedtothenearesthospital

or contact the doctor immediately.

Directions for use:

Do not chew! Swallow the tablet with water.

The tablet can be taken with or without food.

How can you contribute to the success of the treatment?

Complete the full course of treatment as instructed by the doctor.

Thetreatmentislong-term.Youmayberequiredtousethemedicineforseveral

years.

Evenifthereisanimprovementinyourhealth,donotdiscontinueuseofthismedicine

without consulting your doctor

Avoid poisoning!

Thismedicine,andallothermedicines,mustbestoredinasafeplaceoutofthe

reach of children and/or infants, to avoid poisoning.

Ifyouhavetakenanoverdose,orifachildhasaccidentallyswallowedthemedicine,

proceedimmediatelytoahospitalemergencyroomandbringthepackageofthe

medicine with you.

Do not induce vomitingunless explicitly instructed to do so by a doctor!

Thismedicinehasbeenprescribedforthetreatmentofyourailment;inanother

patientitmaycauseharm.Donotgivethismedicinetoyourrelatives,neighbours

or acquaintances.

Donottakemedicinesinthedark!Checkthelabelandthedoseeachtimeyoutake

your medicine. Wear glasses if you need them.

Storage:Below 30°C.

Evenifkeptintheiroriginalcontainerandstoredasrecommended,medicines

maybekeptforalimitedperiodonly.Pleasenotetheexpirydateofthemedicine!

In case of doubt, consult the pharmacist who dispensed the medicine to you.

Do not store different medications in the same package.

License number:14580.33060

Ma ֿnufacturer:

Siegfried Generics (Malta) Ltd., Hal Far, Malta.

Registration holder:

Perrigo Israel Agencies Ltd., 29 Lehi St., Bnei-Brak 51200.

Similar products

Search alerts related to this product

View documents history

Share this information