Oxcarbazepin Teva 150 mg Filmtabletten

Deutschland - Deutsch - BfArM (Bundesinstitut für Arzneimittel und Medizinprodukte)

Kaufe es jetzt

Gebrauchsinformation PIL
Fachinformation SPC
Wirkstoff:
Oxcarbazepin
Verfügbar ab:
TEVA GmbH
INN (Internationale Bezeichnung):
Oxcarbazepine
Darreichungsform:
Filmtablette
Zusammensetzung:
Oxcarbazepin 150.mg
Berechtigungsstatus:
gültig
Zulassungsnummer:
71734.00.00

Gebrauchsinformation OxcarbazepinTeva®150mg Filmtabletten StandSeptember2010

palde-150mg-1009 Seite1

Gebrauchsinformation:InformationfürdenAnwender

OxcarbazepinTeva®150mgFilmtabletten

Wirkstoff:Oxcarbazepin

LesenSiediegesamtePackungsbeilagesorgfältigdurch,bevorSiemitderEinnahmedieses

Arzneimittelsbeginnen.

HebenSiediePackungsbeilageauf.VielleichtmöchtenSiediesespäternochmalslesen.

WennSieweitereFragenhaben,wendenSiesichanIhrenArztoderApotheker.

DiesesArzneimittelwurdeIhnenpersönlichverschrieben.GebenSieesnichtanDritteweiter.Es

kannanderenMenschenschaden,auchwenndiesediegleichenBeschwerdenhabenwieSie.

WenneinederaufgeführtenNebenwirkungenSieerheblichbeeinträchtigtoderSieNebenwirkungen

bemerken,dienichtindieserGebrauchsinformationangegebensind,informierenSiebitteIhrenArzt

oderApotheker.

DiesePackungsbeilagebeinhaltet:

1.WasistOxcarbazepinTeva®150mgundwofürwirdesangewendet?

2.WasmüssenSievorderEinnahmevonOxcarbazepinTeva®150mgbeachten?

3.WieistOxcarbazepinTeva®150mgeinzunehmen?

4.WelcheNebenwirkungensindmöglich?

5.WieistOxcarbazepinTeva®150mgaufzubewahren?

6.WeitereInformationen

1.WASISTOXCARBAZEPINTEVA®150MGUNDWOFÜRWIRDES

ANGEWENDET?

OxcarbazepingehörtzueinerGruppevonArzneimitteln,dieAntikonvulsivagenanntundbeider

BehandlungderEpilepsieeingesetztwerden.EssollbeiPatientenmitEpilepsieKrampfanfälle

verhindern.

OxcarbazepinwirdangewendetzurBehandlungbestimmterEpilepsie-FormenbeiErwachsenenund

Kindernab6Jahren.

IhrArztkannIhnenOxcarbazepinalleinoderinKombinationmitanderenArzneimittelnzur

BehandlungderEpilepsieverschreiben.

2.WASMÜSSENSIEVORDEREINNAHMEVONOXCARBAZEPINTEVA®150MG

BEACHTEN?

OxcarbazepinTeva®150mgdarfNICHTeingenommenwerden,

wennSieüberempfindlich(allergisch)gegenOxcarbazepin,GelborangeS,Aluminiumsalz(E110)

odereinendersonstigenBestandteilediesesArzneimittelssind.

BesondereVorsichtbeiderEinnahmevonOxcarbazepinTeva®150mgisterforderlich

InformierenSieIhrenArzt,wenneinerderfolgendenPunkteaufSiezutrifft.

wennSieüberempfindlichgegenCarbamazepin,einvergleichbaresAntikonvulsivum,odergegen

irgendwelcheanderenArzneimittelsind(z.B.wennSieeinenHautausschlagoderandereAnzeichen

einerAllergiehatten).WennSieüberempfindlichgegenCarbamazepinsind,bestehteinRisikovon

etwa1zu4(25%),dassSieauchüberempfindlichgegenOxcarbazepinsind.

wennSieeineLebererkrankungoderschwereHauterkrankunghabenoderirgendwanneinmalhatten

(sieheAbschnitt4.„WelcheNebenwirkungensindmöglich?“).

wennSieeineNierenerkrankunghabenoderirgendwanneinmalhatten,diemiteinerniedrigen

Natrium(Salz)-KonzentrationimBlutverbundenist/war.Oxcarbazepinkanndie

Natrium-KonzentrationinIhremBlutverringernunddadurcheinenNatriummangelverursachen

(sieheAbschnitt4.„WelcheNebenwirkungensindmöglich?“).WennSieeineNierenerkrankung

Gebrauchsinformation OxcarbazepinTeva®150mg Filmtabletten StandSeptember2010

palde-150mg-1009 Seite2

haben,kannessein,dassIhrArztvorundregelmäßigwährendIhrerBehandlungmitOxcarbazepin

beiIhnenBlutuntersuchungenveranlasst.

wennSieArzneimitteleinnehmen,dieIhreNatrium-Konzentrationverringern(z.B.Diuretika

[„Wassertabletten“]oderSchmerzmittel[NSARwieIndometacinoderIbuprofen]):sieheAbschnitt

„BeiEinnahmevonOxcarbazepinTeva150mgmitanderenArzneimitteln“.

wennSieProblememitdemHerzenodereineHerzleistungsschwäche(Atemnotundgeschwollene

Knöchel)haben.IhrArztwirdSieregelmäßigwiegen,umsicherzustellen,dassIhrKörperkein

Wassereinlagert.

wennSieHerzrhythmusstörungenhaben.

wennSiehormonelleMittelzurEmpfängnisverhütungeinnehmen(die„Pille“):sieheAbschnitt„Bei

EinnahmevonOxcarbazepinTeva150mgmitanderenArzneimitteln“.

wennSieeineSchwangerschaftplanen(sieheAbschnitt„SchwangerschaftundStillzeit“).

BeieinerkleinenZahlvonPatienten,diemitAntiepileptikawieOxcarbazepinbehandeltwurden,kames

zuGedanken,sichselbstzuverletzenodersichdasLebenzunehmen.SetzenSiesichsofortmitIhrem

ArztinVerbindung,wennbeiIhnenirgendwannsolcheGedankenauftreten.

BeiEinnahmevonOxcarbazepinTeva®150mgmitanderenArzneimitteln

InformierenSieIhrenArzt,wennSieeinesderfolgendenArzneimitteleinnehmen,dasich

OxcarbazepinunddieseArzneimittelgegenseitigbeeinflussenkönnen:

andereAntikonvulsiva(z.B.Phenobarbital,Phenytoin,Carbamazepin,Lamotriginoder

Valproinsäure).MöglicherweisemussIhrArztdieDosisdieserArzneimittelbeiIhnenanpassen,

wennSiegleichzeitigOxcarbazepineinnehmen.BeigleichzeitigerEinnahmevonLamotriginbesteht

einerhöhtesRisikofürNebenwirkungenwieÜbelkeit,Schläfrigkeit,Benommenheit/Schwindelund

Kopfschmerzen.

hormonelleMittelzurEmpfängnisverhütung(die„Pille“).OxcarbazepinkanndieWirksamkeit

dieserMittelverringern.WendenSiezusätzlichwirksameMethodenderEmpfängnisverhütungan,

umeineSchwangerschaftzuverhindern.

ArzneimittelzurBehandlungvonpsychiatrischenErkrankungenwieLithiumund

MAO(Monoaminoxidase)-Hemmer(z.B.Phenelzin,Moclobemid).EineKombinationmitLithium

kannzuvermehrtenNebenwirkungenführen.

Arzneimittel,dieIhreNatrium-KonzentrationimBlutverringernwieDiuretika(„Wassertabletten“)

oderSchmerzmittel(NSARwiez.B.IndometacinoderIbuprofen).Oxcarbazepinkanndie

Natrium-KonzentrationinIhremBlutweiterverringern,sodasseszuBeschwerdenim

ZusammenhangmiteinemNatriummangelkommenkann(sieheAbschnitt4.„Welche

Nebenwirkungensindmöglich?“).IhrArztwirdvorundregelmäßigwährendIhrerBehandlungmit

OxcarbazepinIhreNatrium-Konzentrationkontrollieren.

Arzneimittel,diedienatürlicheKörperabwehrhemmen(ImmunsuppressivawieCiclosporinund

Tacrolimus).

BitteinformierenSieIhrenArztoderApotheker,wennSieandereArzneimitteleinnehmen/anwenden

bzw.vorkurzemeingenommen/angewendethaben,auchwennessichumnicht

verschreibungspflichtigeArzneimittelhandelt.

BeiEinnahmevonOxcarbazepinTeva®150mgzusammenmitNahrungsmittelnundGetränken

SiekönnendieTablettenzueinerMahlzeitoderunabhängigvondenMahlzeiteneinnehmen.

SeienSievorsichtig,wennSiewährendderBehandlungmitOxcarbazepinAlkoholtrinken,daesSie

schläfrigmachenkönnte.

SchwangerschaftundStillzeit

BitteinformierenSieIhrenArzt,wennSieschwangersind,glauben,schwangerzuseinoderwährend

derBehandlungmitOxcarbazepineineSchwangerschaftplanen.Esistwichtig,epileptischeAnfälle

währendderSchwangerschaftzuverhindern,aberOxcarbazepinkanndasWachstumIhres

ungeborenenKindesbeeinflussen.

Gebrauchsinformation OxcarbazepinTeva®150mg Filmtabletten StandSeptember2010

palde-150mg-1009 Seite3

IhrArztwirdIhnendieVorteileundRisikeneinerAnwendungvonOxcarbazepinwährendder

Schwangerschafterklären.

SiesolltenwährendderBehandlungmitOxcarbazepinnichtstillen.

FragenSievorderEinnahmevonallenArzneimittelnIhrenArztoderApothekerumRat.

VerkehrstüchtigkeitunddasBedienenvonMaschinen

OxcarbazepinkannNebenwirkungenwieBenommenheit/SchwindelundSchläfrigkeitverursachen.

WennSiehiervorbetroffensind,dürfenSiekeinFahrzeugführenundkeineMaschinenbedienen.

WichtigeInformationenüberbestimmtesonstigeBestandteilevonOxcarbazepinTeva®150mg

PatientenmitLactose-Unverträglichkeitmüssenbeachten,dassOxcarbazepinTeva150mgeinegeringe

MengeLactoseenthält.BittenehmenSieOxcarbazepinTeva150mgdahererstnachRücksprachemit

IhremArztein,wennIhnenbekanntist,dassSieuntereinerUnverträglichkeitgegenüberbestimmten

Zuckernleiden.

DasArzneimittelenthältGelborangeS,Aluminiumsalz(E110)undkannallergischeReaktionen

hervorrufen.

3.WIEISTOXCARBAZEPINTEVA®150MGEINZUNEHMEN?

NehmenSieOxcarbazepinTeva150mgimmergenaunachAnweisungdesArztesein.BittefragenSie

beiIhremArztoderApothekernach,wennSiesichnichtganzsichersind.

FürDosen,diesichmitdieserTablettenstärkenichterreichenlassen,stehenandereDarreichungsformen

undStärkenzurVerfügung.

IhrArztwirdIhreBehandlungwahrscheinlichmiteinerniedrigenDosisbeginnenunddiese,falls

erforderlich,aufdiefürSiebesteDosiserhöhen.FallsvomArztnichtandersverordnet,istdieübliche

Dosis:

Erwachsene:

DieüblicheAnfangsdosisistzweimaltäglich300mg.Wennnotwendig,kannIhrArztIhreDosisin

wöchentlichemAbstandinSchrittenvonhöchstens600mgproTagerhöhen.Dieübliche

ErhaltungsdosisliegtimBereichvon600bis2400mgproTag.

WennSiegleichzeitigweitereAntikonvulsivaeinnehmen,kannessein,dassIhrArztdieDosisdieser

anderenArzneimittelverringernoderdieDosisvonOxcarbazepinlangsamererhöhenmuss.

WennandereArzneimitteldurchOxcarbazepinersetztwerden,solltendieDosendieseranderen

Arzneimittellangsamverringertwerden.

Kinderab6Jahren:

DieüblicheAnfangsdosisist8-10mg/kgKörpergewichtproTag,verteiltauf2Einnahmen.Wenn

notwendig,kannderArztdieDosisinwöchentlichenAbständeninSchrittenvonhöchstens10mg/kg

proTagbisaufeineHöchstdosisvon46mg/kgKörpergewichtproTagerhöhen.Dieübliche

ErhaltungsdosisinKombinationmitanderenAntikonvulsivabeträgt30mg/kgKörpergewichtproTag.

Kinderunter6Jahren:

OxcarbazepinwirdnichtempfohlenfürdieAnwendungbeiKindernunter6Jahren,daseine

UnbedenklichkeitundWirksamkeitindieserAltersgruppenichtnachgewiesenwurden.

BeiPatienten,diekeineTabletteneinnehmenkönnenoderbeidenendieerforderlicheDosisnichtmit

Tablettenerreichtwerdenkann,stehenandereDarreichungsformenvonOxcarbazepinzurVerfügung.

PatientenmitNierenerkrankung:

WennSieNierenproblemehaben(eingeschränkteNierenfunktion),wirdIhrArztIhreBehandlungmit

derHälftedernormalenDosis(sieheoben)beginnenunddieDosisbeiIhnenlangsamererhöhen.

PatientenmitschwererLebererkrankung:

BefolgenSiedieEmpfehlungenIhresArztes,wennSieschwereLeberproblemehaben.

FürDosen,diesichmitdieserTablettenstärkenichterreichenlassen,stehenandereDarreichungsformen

undStärkenzurVerfügung.

ArtderAnwendung:

Gebrauchsinformation OxcarbazepinTeva®150mg Filmtabletten StandSeptember2010

palde-150mg-1009 Seite4

DieFilmtablettenmiteinemGlasWassereinnehmen.SiedürfendieTablettennichtzerstoßenoder

zerkauen.UmdieEinnahmezuerleichtern,lassensichdieFilmtabletteninzweiHälftenteilen.

WennSieeinegrößereMengevonOxcarbazepinTeva®150mgeingenommenhaben,alsSie

sollten

WennSie(oderirgendjemandanderes)einegroßeMengederTablettenaufeinmaleingenommen

haben/hatoderwennSieglauben,dasseinKindeinederTabletteneingenommenhat,müssenSiesich

sofortmitderNotfallambulanzdesnächstgelegenenKrankenhausesoderIhremArztinVerbindung

setzen.BittenehmenSiediesePackungsbeilage,eventuelleverbleibendeTablettenunddasBehältnismit

insKrankenhausoderzuIhremArzt,damitderbehandelndeArztweiß,welcheTabletteneingenommen

wurden.

EineÜberdosiskannSchläfrigkeit,Benommenheit/Schwindel,Übelkeit,Erbrechen,eineungewöhnliche

Muskel-undKörperaktivität,unkoordinierteBewegungenundunwillkürlicheAugenbewegungen

verursachen.

WennSiedieEinnahmevonOxcarbazepinTeva®150mgvergessenhaben

WennSieeineEinnahmevergessenhaben,nehmenSieeineDosisein,sobaldSiedarandenken,essei

denn,esistfastZeitfürdienächsteEinnahme.NehmenSiedienächsteDosiswiegewöhnlichein.

NehmenSienichtdiedoppelteDosisein,wennSiedievorherigeEinnahmevergessenhaben.

WennSiedieEinnahmevonOxcarbazepinTeva®150mgabbrechen

BeendenSiedieEinnahmevonOxcarbazepinnur,wennIhrArztesIhnensagt.WennSiedieEinnahme

beenden,kanneszueinerplötzlichenVerstärkungIhrerKrampfanfällekommen.IhrArztwird

entscheiden,wannundwieIhreBehandlungbeendetwird.

WennSieweitereFragenzurAnwendungdesArzneimittelshaben,fragenSieIhrenArztoder

Apotheker.

4.WELCHENEBENWIRKUNGENSINDMÖGLICH?

WiealleArzneimittelkannOxcarbazepinTeva150mgNebenwirkungenhaben,dieabernichtbei

jedemauftretenmüssen.

SetzenSiesichunverzüglichmitIhremArztinVerbindungodersuchenSiesofortdieNotfallambulanz

desnächstgelegenenKrankenhausesauf,wenndiefolgendenBeschwerdenbeiIhnenauftreten:

einschwererHautausschlagwiez.B.:

eineschwereallergischeReaktionmit(hohem)Fieber,rotenFleckenaufderHaut,

Gliederschmerzenund/oderAugenschmerzen

eineplötzliche,schwereallergischeReaktionmitFieberundBlasenbildungsowieSchuppenauf

derHaut

rote(feuchte)unregelmäßigeFlecken.

DieseNebenwirkungistsehrseltenundtrittbeiwenigerals1Behandeltenvon10000auf,kann

abereineärztlicheBehandlungerforderlichmachen.WennesbeiIhnenwährendderBehandlung

mitOxcarbazepinzueinerReaktiondiesesTypskommt,dürfenSieOxcarbazepinnichtnoch

einmaleinnehmen.

ZeicheneinerLeberentzündung(wieGelbfärbungderHautoderderweißenAugenabschnitte).

DieseNebenwirkungistsehrseltenundtrittbeiwenigerals1Behandeltenvon10000auf,eskann

allerdingssein,dassIhreLeberfunktionüberwachtwerdenmuss.

SchwellungvonGesicht,ZungeoderRachen,SchluckstörungenoderNesselsucht(Quaddeln)mit

AtembeschwerdenoderandereHinweiseaufeineallergischeReaktionwieHautausschlag,Fieber

oderGelenkschmerzen.

DieseNebenwirkungistsehrseltenundtrittbeiwenigerals1Behandeltenvon10000auf.

SetzenSiesichsofortmitIhremArztinVerbindung,wenneinederfolgendenNebenwirkungenbei

Ihnenauftritt:

Gebrauchsinformation OxcarbazepinTeva®150mg Filmtabletten StandSeptember2010

palde-150mg-1009 Seite5

WennSiefeststellen,dassIhrHerzunregelmäßigschlägt.

DieseNebenwirkungistsehrseltenundtrittbeiwenigerals1Behandeltenvon10000auf,kann

abereineärztlicheBehandlungerforderlichmachen.

WennSiesichverwirrtfühlenoderIhnenübelist,Sieerbrechenmüssen,IhrBewusstsein

eingeschränktist,SieverschwommensehenoderwennSiehäufigereKrampfanfällehaben(dabei

handeltessichumBeschwerden,dieimZusammenhangmiteinerniedrigenNatrium-Konzentration

inIhremBlutauftreten).

DieseNebenwirkungistsehrseltenundtrittbeiwenigerals1Behandeltenvon10000auf,kann

abereineärztlicheBehandlungerforderlichmachen.

WennSieBeschwerdenfeststellen,dieaufeineStörungdesBluteshinweisenwiezumBeispiel

Müdigkeit,AtemnotunterkörperlicherBelastung,Blässe,Kopfschmerzen,Schüttelfrost,

Benommenheit/Schwindel,häufigeInfektionenmitFieber,Halsschmerzen,Geschwürenim

Mundbereich,häufigereBlutungenoderblaueFleckenalsgewöhnlich,Nasenbluten,rötlicheoder

leichtvioletteFleckeoderanderenichterklärbareFleckenaufderHaut.

DieseNebenwirkungistsehrseltenundtrittbeiwenigerals1Behandeltenvon10000auf,kann

abereineärztlicheBehandlungerforderlichmachen.

AndereNebenwirkungen,dieauftretenkönnen,sind:

Sehrhäufig(auftretenbeimehrals1von10Behandelten):

Benommenheit,MüdigkeitoderSchläfrigkeit,Kopfschmerzen

Doppeltsehen

ÜbelkeitoderErbrechen.

Häufig(auftretenbei1bis10von100Behandelten):

niedrigeNatrium(Salz)-KonzentrationimBlut

Verwirrtheit,Depression,Apathie,ErregtheitoderandereStimmungsstörungen

verschwommenesSehen,unkontrollierteAugenbewegungenoderandereSehstörungen

Koordinationsstörungen,Zittern,Unfähigkeit,sichzukonzentrieren,Gedächtnisstörungen

DurchfalloderVerstopfung,SchmerzenimBauchraum

Hautausschlag,Akne

Haarausfall

Schwächegefühl.

Gelegentlich(auftretenbei1bis10von1000Behandelten):

Juckreiz

VeränderungendesBluteswieeineverringerteAnzahlvonweißenBlutkörperchenundein

KonzentrationsanstiegderLeberenzyme.

Sehrselten(auftretenbeiwenigerals1von10000Behandelten):

VeränderungendesBluteswieeineVerringerungderanderBlutgerinnungbeteiligtenZellen

(Blutplättchen),EntzündungderBauchspeicheldrüseundVeränderungendesImmunsystems,

möglicherweisemitGliederschmerzen,FieberundVeränderungderLeberfunktion.

Unbekannt(HäufigkeitaufGrundlagederverfügbarenDatennichtabschätzbar):

Bluthochdruck.

InformierenSiebitteIhrenArztoderApotheker,wenneinederaufgeführtenNebenwirkungenSie

erheblichbeeinträchtigtoderSieNebenwirkungenbemerken,dienichtindieserGebrauchsinformation

angegebensind.

5.WIEISTOXCARBAZEPINTEVA®150MGAUFZUBEWAHREN?

ArzneimittelfürKinderunzugänglichaufbewahren.

SiedürfenOxcarbazepinTeva150mgnachdemaufderBlisterpackungunddemUmkartonnach

„verwendbarbis“angegebenenVerfallsdatumnichtmehranwenden.DasVerfallsdatumbeziehtsichauf

denletztenTagdesMonats.

FürdiesesArzneimittelsindkeinebesonderenLagerungsbedingungenerforderlich.

Gebrauchsinformation OxcarbazepinTeva®150mg Filmtabletten StandSeptember2010

palde-150mg-1009 Seite6

DasArzneimitteldarfnichtimAbwasseroderHaushaltsabfallentsorgtwerden.FragenSieIhren

ApothekerwiedasArzneimittelzuentsorgenist,wennSieesnichtmehrbenötigen.DieseMaßnahme

hilftdieUmweltzuschützen.

6.WEITEREINFORMATIONEN

WasOxcarbazepinTeva®150mgenthält

DerWirkstoffist:Oxcarbazepin.JedeFilmtabletteenthält150mgOxcarbazepin.

DiesonstigenBestandteilesind:

Tablettenkern:Lactose-Monohydrat,Maisstärke,Crospovidon(TypA),Povidon(K30),

mikrokristallineCellulose,Carboxymethylstärke-Natrium(TypA),hochdispersesSiliciumdioxidund

Magnesiumstearat.

Filmüberzug:Hypromellose,Macrogol6000,Macrogol400,Titandioxid(E171),

Eisen(III)-hydroxid-oxidxH2O(E172),GelborangeS,Aluminiumsalz(E110).

WieOxcarbazepinTeva®150mgaussiehtundInhaltderPackung

Filmtablette

OxcarbazepinTeva150mgFilmtablettensindgelbebisdunkelgelbekapselförmigeFilmtabletten.

DieeineSeitederTablettehatinderMitteeineBruchkerbeundträgtaufdereinenSeiteder

BruchkerbediePrägung„9“undaufderanderendiePrägung„3“.DieandereSeitederTablettehat

inderMitteeineBruchkerbeundträgtaufdereinenSeitederBruchkerbediePrägung„72“undauf

deranderendiePrägung„81“.DieTablettekanningleicheHälftengeteiltwerden.

OxcarbazepinTeva150mgistinPackungsgrößenmit50(N1),100(N2)und200(N3)

Filmtablettenerhältlich.

PharmazeutischerUnternehmerundHersteller

PharmazeutischerUnternehmer

TEVAGmbH

Wasastraße50

01445Radebeul

Hersteller

TEVAUKLimited

BramptonRoad,HampdenPark

Eastbourne,EastSussex

BN229AG

VereinigtesKönigreich

DiesesArzneimittelistindenMitgliedsstaatendesEuropäischenWirtschaftsraumes(EWR)unter

denfolgendenBezeichnungenzugelassen:

VereinigtesKönigreich:Oxcarbazepine150mgFilm-coatedTablets

Österreich: OxcarbazepinTeva150mg-Filmtabletten

Bulgarien: TEVALEPTIN150mgФилмиранитаблетки

Zypern: Oxcarbazepin-TEVA150

Deutschland: OxcarbazepinTeva150mgFilmtabletten

Dänemark: OxcarbazepinTeva

Estland: OxcarbazepineTeva150mg

Griechenland: OxcarbazepineTeva150mgΕπικαλυμμέναμελεπτόυμένιο

Finnland: OxcarbazepineTeva150mgtabletti,kalvopäällysteinen

Frankreich: OxcarbazepineTEVA150mgcomprimépelliculé

Ungarn: Oxcar-Teva150mgfilmtabletta

Irland: OxcarbazepineTEVA150mgFilm-coatedTablets

Litauen: OxcarbazepineTeva150mgplėveledengtostabletės

Lettland: OxcarbazepineTeva

Gebrauchsinformation OxcarbazepinTeva®150mg Filmtabletten StandSeptember2010

palde-150mg-1009 Seite7

Malta: OxcarbazepineTeva150mgFilm-coatedTablets

Norwegen: OxcarbazepineTEVA150mgfilmdrasjertetabletter

Polen: Epinorm

Portugal: OxcarbazepinaTeva

Schweden: OxcarbazepineTeva150mgfilmdrageradetabletter

DieseGebrauchsinformationwurdezuletztgenehmigtimSeptember2010.

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

1. BEZEICHNUNGDERARZNEIMITTEL

OxcarbazepinTeva ® 150mgFilmtabletten

OxcarbazepinTeva ® 300mgFilmtabletten

OxcarbazepinTeva ® 600mgFilmtabletten

2. QUALITATIVEUNDQUANTITATIVEZUSAMMENSETZUNG

OxcarbazepinTeva150mgFilmtabletten

EineFilmtabletteenthält150mgOxcarbazepin.

SonstigeBestandteile

EineFilmtabletteenthält8,32mgLactoseund0,02mgGelborangeS,Aluminiumsalz(E110).

DievollständigeAuflistungdersonstigenBestandteilesieheAbschnitt6.1.

OxcarbazepinTeva300mgFilmtabletten

EineFilmtabletteenthält300mgOxcarbazepin.

SonstigeBestandteile

EineFilmtabletteenthält16,63mgLactoseund0,04mgGelborangeS,Aluminiumsalz(E110).

DievollständigeAuflistungdersonstigenBestandteilesieheAbschnitt6.1.

OxcarbazepinTeva600mgFilmtabletten

EineFilmtabletteenthält600mgOxcarbazepin.

SonstigeBestandteile

EineFilmtabletteenthält33,25mgLactoseund0,08mgGelborangeS,Aluminiumsalz(E110).

DievollständigeAuflistungdersonstigenBestandteilesieheAbschnitt6.1.

3. DARREICHUNGSFORM

Filmtablette

OxcarbazepinTeva150mgFilmtabletten

GelbebisdunkelgelbekapselförmigeFilmtablette.DieeineSeitederTablettehatinderMitteeine

BruchkerbeundträgtaufdereinenSeitederBruchkerbediePrägung„9“undaufderanderendie

Prägung„3“.DieandereSeitederTablettehatinderMitteeineBruchkerbeundträgtaufdereinen

SeitederBruchkerbediePrägung„72“undaufderanderendiePrägung„81“.

DieTablettekanningleicheHälftengeteiltwerden.

OxcarbazepinTeva300mgFilmtabletten

GelbebisdunkelgelbekapselförmigeFilmtablette.DieeineSeitederTablettehatinderMitteeine

BruchkerbeundträgtaufdereinenSeitederBruchkerbediePrägung„9“undaufderanderendie

Prägung„3“.DieandereSeitederTablettehatinderMitteeineBruchkerbeundträgtaufdereinen

SeitederBruchkerbediePrägung„72“undaufderanderendiePrägung„82“.

DieTablettekanningleicheHälftengeteiltwerden.

OxcarbazepinTeva600mgFilmtabletten

GelbebisdunkelgelbekapselförmigeFilmtablette.DieeineSeitederTablettehatinderMitteeine

BruchkerbeundträgtaufdereinenSeitederBruchkerbediePrägung„9“undaufderanderendie

Prägung„3“.DieandereSeitederTablettehatinderMitteeineBruchkerbeundträgtaufdereinen

SeitederBruchkerbediePrägung„72“undaufderanderendiePrägung„83“.

DieTablettekanningleicheHälftengeteiltwerden.

de_29414 Seite1 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

4. KLINISCHEANGABEN

4.1Anwendungsgebiete

OxcarbazepinistangezeigtzurBehandlungpartiellerAnfällemitoderohnesekundärgeneralisierten

tonisch-klonischenAnfällen.

EsistangezeigtzurMonotherapieoderKombinationstherapiebeiErwachsenenundKindernab6

Jahren.

4.2Dosierung,ArtundDauerderAnwendung

DieBehandlungmitOxcarbazepinwirdalsMonotherapieoderimRahmeneiner

KombinationstherapieineinerklinischwirksamenDosisbegonnen,dieaufzweiEinnahmenproTag

verteiltwird.DieDosiskannabhängigvomklinischenAnsprechendesPatientenerhöhtwerden.

WennandereAntiepileptikadurchOxcarbazepinersetztwerden,solltedieDosisdesbegleitend

verabreichtenAntiepileptikumsbzw.derbegleitendverabreichtenAntiepileptikabeiBeginnder

Oxcarbazepin-Therapieschrittweisereduziertwerden.

ImRahmenderKombinationstherapiemusswegendererhöhtenAntiepileptika-Gesamtexpositiondes

PatientenmöglicherweisedieDosisderbegleitendverabreichtenAntiepileptikareduziertund/oderdie

Oxcarbazepin-Dosislangsamererhöhtwerden(sieheAbschnitt4.5).

OxcarbazepinkannzuoderunabhängigvondenMahlzeiteneingenommenwerden.

DiefolgendenDosierungsempfehlungengeltenfürallePatientenohneBeeinträchtigungder

Nierenfunktion(sieheAbschnitt5.2).EineÜberwachungderPlasmakonzentrationendesWirkstoffs

zurOptimierungderOxcarbazepin-Therapieistnichterforderlich.

UmdemPatientendieEinnahmezuerleichtern,habendieTabletteneineBruchkerbeundkönnenin

zweiHälftengeteiltwerden.FürKinder,diekeineTabletteneinnehmenkönnenoderbeidenensich

dieerforderlicheDosisnichtmitTablettenerreichenlässt,stehenandereDosisstärkenund

DarreichungsformenzurVerfügung.

Erwachsene

Monotherapie

DieBehandlungmitOxcarbazepinsollteineinerDosisvon600mg/Tag(8-10mg/kg/Tag),verteiltauf

zweiEinnahmen,begonnenwerden.Wennklinischindiziert,kanndieDosisinetwawöchentlichem

AbstandinSchrittenvonmaximal600mg/TagüberdieAnfangsdosishinauserhöhtwerden,umdie

gewünschteklinischeWirkungzuerzielen.EinetherapeutischeWirkungwirdbeiDosenzwischen600

mg/Tagund2400mg/Tagbeobachtet.

InkontrolliertenMonotherapie-StudienzuPatienten,diegeradenichtmitAntiepileptikabehandelt

wurden,erwiesensich1200mg/TagalseffektiveDosis.Dagegenwarenbeistärkerrefraktären

Patienten,dievonanderenAntiepileptikaaufeineOxcarbazepin-Monotherapieumgestelltwurden,

2400mg/Tagwirksam.BeikontrollierterstationärerBehandlungimKrankenhauswareninnerhalb

von48StundenDosiserhöhungenvonbiszu2400mg/Tagmöglich.

Kombinationstherapie

de_29414 Seite2 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

DieBehandlungmitOxcarbazepinsollteineinerDosisvon600mg/Tag(8-10mg/kg/Tag),verteiltauf

zweiEinnahmen,begonnenwerden.Wennklinischindiziert,kanndieDosisinetwawöchentlichem

AbstandinSchrittenvonmaximal600mg/TagüberdieAnfangsdosishinauserhöhtwerden,umdie

gewünschteklinischeWirkungzuerzielen.EinetherapeutischeWirkungwirdbeiDosenzwischen600

mg/Tagund2400mg/Tagbeobachtet.

IneinerkontrolliertenStudiezurKombinationstherapieerwiesensichTagesdosenvon600bis2400

mg/Tagalswirksam,auchwenndiemeistenPatientendie2400mg/Tag-Dosisnichtohne

DosisreduktionderbegleitendenAntiepileptikavertrugen.HauptgrundwarenZNS-bezogene

unerwünschteEreignisse.Tagedosenüber2400mg/TagwurdennichtsystematischimRahmenvon

klinischenStudienuntersucht.

ÄlterePatienten

BeiälterenPatientenmiteingeschränkterNierenfunktionwirdeineDosisanpassungempfohlen(siehe

„PatientenmiteingeschränkterNierenfunktion“).ZuPatientenmitHyponatriämie-Risikosiehe

Abschnitt4.4.

Kinder

DieBehandlungmitOxcarbazepinsolltesowohlalsMonotherapiealsauchimRahmeneiner

KombinationstherapieineinerDosisvon8-10mg/kg/Tag,verteiltaufzweiEinnahmen,begonnen

werden.ImRahmenderKombinationstherapiewurdeuntereinermittlerenErhaltungsdosisvonetwa

30mg/kg/TageineWirkungbeobachtet.FallsklinischindiziertkanndieDosisinetwawöchentlichem

AbstandinSchrittenvonmaximal10mg/kg/TagvonderAnfangsdosisbisaufeineHöchstdosisvon

46mg/kg/Tagerhöhtwerden,umdiegewünschtetherapeutischeWirkungzuerzielen(sieheAbschnitt

5.2).

OxcarbazepinwirdfürdieAnwendungbeiKindernab6Jahrenempfohlen.Unbedenklichkeitund

WirksamkeitwurdenimRahmenvonkontrolliertenklinischenStudienanetwa230KindernimAlter

vonunter6Jahrenuntersucht(bisherunterauf1Monat).

OxcarbazepinwirdnichtempfohlenfürdieAnwendungbeiKindernunter6Jahren,dadie

UnbedenklichkeitundWirksamkeitnichtangemessennachgewiesenwurden.

AlleobigenDosierungsempfehlungen(Erwachsene,ältereMenschenundKinder)basierenaufdenin

klinischenStudienfüralleAltersgruppenuntersuchtenDosen.Allerdingskönnen,soferngeeignet,

niedrigereAnfangsdoseninBetrachtgezogenwerden.

PatientenmiteingeschränkterLeberfunktion

BeiPatientenmitleichterbismittelschwererEinschränkungderLeberfunktionistkeine

Dosisanpassungerforderlich.

OxcarbazepinwurdenichtbeiPatientenmitschwererEinschränkungderLeberfunktionuntersucht.

AusdiesemGrundistbeiPatientenmitschwererEinschränkungderLeberfunktionVorsichtgeboten

(sieheAbschnitt5.2).

PatientenmiteingeschränkterNierenfunktion

BeiPatientenmiteingeschränkterNierenfunktion(Creatinin-Clearanceunter30ml/min)solltedie

Oxcarbazepin-TherapiemitderHälftederüblichenAnfangsdosis(300mg/Tag)begonnenundin

AbständenvonmindestenseinerWocheerhöhtwerden,bisdiegewünschteklinischeWirkungerzielt

wurde(sieheAbschnitt5.2).

PatientenmiteingeschränkterNierenfunktionmüsseninderPhaseeinerDosiserhöhungsorgfältiger

überwachtwerden.

4.3Gegenanzeigen

de_29414 Seite3 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

ÜberempfindlichkeitgegendenWirkstoff,GelborangeS,Aluminiumsalz(E110)odereinender

sonstigenBestandteile.

4.4BesondereWarnhinweiseundVorsichtsmaßnahmenfürdieAnwendung

Überempfindlichkeit

ImRahmenderPostmarketing-ErfahrungwurdeüberÜberempfindlichkeitsreaktionenvomTypI

(Sofortreaktionen)wieHautausschlag,Pruritus,Urtikaria,AngioödemeundAnaphylaxieberichtet.

FällevonAnaphylaxieundAngioödemenmitBeteiligungvonLarynx,Glottis,Lippenund

AugenlidernwurdensowohlnachdererstenalsauchnachspäterenOxcarbazepin-Dosenbeschrieben.

WennesbeieinemPatientennacheinerBehandlungmitOxcarbazepinzuderartigenReaktionen

kommt,mussdasArzneimittelabgesetztundeineandereBehandlungbegonnenwerden.

Patienten,dieÜberempfindlichkeitsreaktionenaufCarbamazepinzeigten,müssendarüberinformiert

werden,dassesin25-30%derFälleauchzuÜberempfindlichkeitsreaktionen(z.B.schwere

Hautreaktionen)aufOxcarbazepinkommenkann(sieheAbschnitt4.8).

ÜberempfindlichkeitsreaktionenaufOxcarbazepinwieMultiorgan-Überempfindlichkeitsreaktionen

könnenauchbeiPatientenohneÜberempfindlichkeitsreaktionaufCarbamazepininderVorgeschichte

auftreten.

DerartigeReaktionenkönnenHaut,Leber,BlutundLymphsystemoderandereOrganebetreffen,und

zwarentwedereinzelnoderzusammenimSinneeinersystemischenReaktiongleichzeitig(siehe

Abschnitt4.8).ImAllgemeinensolltedieOxcarbazepin-Therapiesofortabgebrochenwerden,wenn

ZeichenoderSymptomeauftreten,dieaufeineÜberempfindlichkeithinweisen(sieheAbschnitt4.8).

DermatologischeReaktionen

InsehrseltenenFällenwurdeimZusammenhangmitderAnwendungvonOxcarbazepinüber

schwerwiegendedermatologischeReaktionenwieStevens-Johnson-Syndrom,toxischeepidermale

Nekrolyse(Lyell-Syndrom)undErythemamultiformeberichtet.Patientenmitschwerwiegenden

dermatologischenReaktionenbenötigenmöglicherweiseeinestationäreBehandlung,dadiese

ErkrankungenlebensbedrohlichseinkönnenundinsehrseltenenFällentödlichverlaufen.Im

ZusammenhangmitOxcarbazepinstehendeFällewurdensowohlbeiKindernalsauchbei

Erwachsenenbeobachtet.DiemedianeZeitbiszuihremAuftretenbetrug19Tage.Eswurdeüber

EinzelfällemitwiederholtemAuftretenderschwerwiegendenHautreaktionbeierneuterExposition

mitOxcarbazepinberichtet.Patienten,beidenenesunterderBehandlungzueinerHautreaktion

kommt,müssensofortuntersuchtwerdenunddieOxcarbazepin-Behandlungunverzüglichbeendet

werden,esseidenn,derHautausschlagstehteindeutignichtimZusammenhangmitdieser

Behandlung.BeiBeendigungderBehandlungistdaraufzuachten,Oxcarbazepinzur

AnfallsprophylaxedurcheinanderesAntiepileptikumzuersetzen.DieOxcarbazepin-Therapiedarfbei

Patienten,diedieBehandlungwegeneinerÜberempfindlichkeitsreaktionabgebrochenhaben,nicht

wiederaufgenommenwerden(sieheAbschnitt4.3).

Hyponatriämie

Bei2,7%dermitOxcarbazepinbehandeltenPatientenwurdenNatrium-Serumkonzentrationenvon

unter125mmol/lbeobachtet,dieinderRegelasymptomatischwarenundkeineAnpassungder

Behandlungerforderlichmachten.DieErfahrungenausklinischenStudienzeigen,dassdieNatrium-

SerumkonzentrationennachReduktionderOxcarbazepin-Dosis,AbsetzenvonOxcarbazepinoder

konservativerBehandlungderPatienten(z.B.EinschränkungderFlüssigkeitszufuhr)inden

Normbereichzurückkehrten.BeiPatientenmitvorbestehender,miteinerniedrigenNatrium-

KonzentrationverbundenerNierenerkrankungodersolchen,diegleichzeitigdieNatrium-

KonzentrationsenkendeArzneimittel(z.B.Diuretika,Desmopressin)undNSAR(z.B.Indometacin)

de_29414 Seite4 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

erhalten,istvorBeginnderBehandlungdieNatrium-Serumkonzentrationzubestimmen.

AnschließendsolltedieNatrium-SerumkonzentrationnachetwazweiWochenunddannüberdie

erstendreiBehandlungsmonateinmonatlichemAbstandoderwennklinischerforderlichkontrolliert

werden.DiegenanntenRisikofaktorentreffenmöglicherweiseinsbesonderefürälterePatientenzu.

WennbeieinemmitOxcarbazepinbehandeltenPatienteneineBehandlungmiteinemdieNatrium-

KonzentrationensenkendenArzneimittelbegonnenwird,solltendieNatrium-Konzentrationennach

gleichemMusterkontrolliertwerden(sieheAbschnitt4.8).AllgemeinisteineKontrollederNatrium-

SerumkonzentrationinBetrachtzuziehen,wenneswährendeinerBehandlungmitOxcarbazepinzu

Symptomenkommt,dieaufeineHyponatriämiehinweisen(sieheAbschnitt4.8).Beidenanderen

PatientenkönnendieNatrium-SerumkonzentrationenimRahmenderroutinemäßigen

Laboruntersuchungenkontrolliertwerden.

BeiallenPatientenmitHerzinsuffizienzundsekundärerHerzinsuffizienzmussregelmäßigdas

Körpergewichtkontrolliertwerden,umeineFlüssigkeitseinlagerungzuerkennen.Bei

FlüssigkeitseinlagerungoderVerschlechterungderHerzfunktionistdieNatrium-Serumkonzentration

zukontrollieren.ImFalleeinerHyponatriämieisteineEinschränkungderFlüssigkeitszufuhreine

wichtigeGegenmaßnahme.DaOxcarbazepininsehrseltenenFällendieErregungsleitungimHerzen

beeinträchtigenkann,müssenPatientenmitvorbestehenderErregungsleitungsstörung(z.B.

Atrioventrikularblock,Arrhythmie)sorgfältigbeobachtetwerden.

Leberfunktion

SehrseltenwurdeüberFällevonHepatitisberichtet,dieinderMehrzahleinengünstigenVerlauf

zeigten.BeiVerdachtaufeinhepatischesEreignisistdieLeberfunktionzukontrollierenundein

AbsetzenderOxcarbazepin-TherapieinBetrachtzuziehen.

HämatologischeReaktionen

ImRahmenderPostmarketing-ErfahrungwurdebeimitOxcarbazepinbehandeltenPatienteninsehr

seltenenFälleneineAgranulozytose,aplastischeAnämieundPanzytopeniebeschrieben(siehe

Abschnitt4.8).

BeiHinweisenaufeinesignifikanteKnochenmarkdepressionisteinAbsetzendesArzneimittelsin

Betrachtzuziehen.

HormonelleKontrazeptiva

PatientinnenimgebärfähigenAltermüssendaraufhingewiesenwerden,dassdiegleichzeitige

AnwendungvonOxcarbazepinmithormonellenKontrazeptivadieseFormderKontrazeption

unwirksammachenkann(sieheAbschnitt4.5).BeiAnwendungvonOxcarbazepinwerdenzusätzliche

nicht-hormonelleMethodenderKontrazeptionempfohlen.

Alkohol

BeiEinnahmevonOxcarbazepininKombinationmitAlkoholistwegeneinermöglichenadditiven

sedativenWirkungVorsichtgeboten.

Absetzen

Oxcarbazepinsollteschrittweiseabgesetztwerden,umdasRisikofüreineZunahmeder

Anfallshäufigkeitmöglichstgeringzuhalten.

Suizidgedanken

ÜbersuizidaleGedankenundsuizidalesVerhaltenwurdebeiPatienten,diemitAntiepileptikain

verschiedenenIndikationenbehandeltwurden,berichtet.EineMetaanalyserandomisierter,Placebo-

kontrollierterStudienmitAntiepileptikazeigteaucheinleichterhöhtesRisikofürdasAuftretenvon

SuizidgedankenundsuizidalemVerhalten.DerMechanismusfürdieAuslösungdieserNebenwirkung

istnichtbekanntunddieverfügbarenDatenschließendieMöglichkeiteineserhöhtenRisikosbeider

EinnahmevonOxcarbazepinnichtaus.

de_29414 Seite5 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

DeshalbsolltenPatientenhinsichtlichAnzeichenvonSuizidgedankenundsuizidalen

VerhaltensweisenüberwachtundeinegeeigneteBehandlunginErwägunggezogenwerden.Patienten

(undderenBetreuern)solltegeratenwerdenmedizinischeHilfeeinzuholen,wennAnzeichenfür

SuizidgedankenodersuizidalesVerhaltenauftreten.

SonstigeBestandteile

DieArzneimittelenthaltenLactose-Monohydrat.PatientenmitderseltenenhereditärenGalactose-

Intoleranz,Lactase-MangeloderGlucose-Galactose-MalabsorptionsolltendieseArzneimittelnicht

einnehmen.

DieArzneimittelenthaltenGelborangeS,Aluminiumsalz(E110)undkönnenallergischeReaktionen

hervorrufen.

4.5WechselwirkungenmitanderenArzneimittelnundsonstigeWechselwirkungen

Enzyminduktion

OxcarbazepinundseinpharmakologischwirksamerMetabolit(dasMonohydroxy-Derivat,MHD)sind

invitroundinvivoschwacheInduktorenderCytochrom-P450-EnzymeCYP3A4undCYP3A5,die

fürdieVerstoffwechselungsehrvielerSubstanzenverantwortlichsindwiez.B.von

Immunsuppressiva(z.B.Ciclosporin,Tacrolimus),oralenKontrazeptiva(sieheunten)undeinigen

anderenAntiepileptika(z.B.Carbamazepin).DadurchverringernsichdiePlasmakonzentrationender

genanntenArzneimittel(dieTabelleweiteruntenenthältdieErgebnissezuanderenAntiepileptika).

OxcarbazepinundMHDsindinvitroschwacheInduktorenderUDP-Glucuronyltransferasen(die

AuswirkungenaufspezielleEnzymedieserFamiliesindnichtbekannt).DaherkönnenOxcarbazepin

undMHDinvivoeineleichteinduzierendeWirkungaufdenMetabolismusvonArzneimittelnhaben,

dievorwiegendübereineKonjugationdurchdieUDP-Glucuronyltransferaseneliminiertwerden.Bei

BeginnderBehandlungmitOxcarbazepinoderbeiÄnderungderDosierungwirddasneue

Induktionsniveaumöglicherweiseerstnach2bis3Wochenerreicht.

BeiBeendigungderOxcarbazepin-TherapiekanneineDosisreduktionderbegleitendverabreichten

Arzneimittelerforderlichwerden,überdieaufderGrundlagederklinischenÜberwachungund/oder

einerÜberwachungderPlasmaspiegelzuentscheidenist.Esistdavonauszugehen,dassdieInduktion

2bis3WochennachBeendigungderBehandlungschrittweisenachlässt.

HormonelleKontrazeptiva:Eswurdegezeigt,dassOxcarbazepindiebeidenKomponentenoraler

Kontrazeptiva,Ethinylestradiol(EO)undLevonorgestrel(LNG),beeinflussenkann.Diemittleren

AUC-WertevonEOundLNGnahmenum48-52%bzw.32-52%ab.AusdiesemGrundkanndie

gleichzeitigeAnwendungvonOxcarbazepinmithormonellenKontrazeptivazurUnwirksamkeitder

Kontrazeptivaführen(sieheAbschnitt4.4).EsmusseineanderezuverlässigeFormderKontrazeption

angewendetwerden.

Enzymhemmung

OxcarbazepinundMHDhemmenCYP2C19.DaherkannesbeigleichzeitigerVerabreichunghoher

Oxcarbazepin-DosenmitArzneimitteln,dievorwiegendüberCYP2C19verstoffwechseltwerden(z.

B.Phenytoin),zuArzneimittelwechselwirkungenkommen.BeiVerabreichungvonOxcarbazepinin

Dosenvonmehrals1200mg/TagstiegendiePhenytoin-Spiegelumbiszu40%an(diefolgende

TabellefasstdieErgebnissezuanderenAntikonvulsivazusammen).IndiesemFallkanneine

ReduktionderbegleitendverabreichtenPhenytoin-Dosiserforderlichwerden(sieheAbschnitt4.2).

Antiepileptika

de_29414 Seite6 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

ImRahmenvonklinischenStudienwurdenmöglicheWechselwirkungenzwischenOxcarbazepinund

anderenAntiepileptikauntersucht.DieAuswirkungendieserWechselwirkungenaufdieMittelwerte

vonAUCundC

sindinderfolgendenTabellezusammengefasst.

ÜberblicküberWechselwirkungenzwischenOxcarbazepinundanderenAntiepileptika

gleichzeitigverabreichtes

Antiepileptikum EinflussvonOxcarbazepinaufdie

Konzentrationdesanderen

Antiepileptikums EinflussdesAntiepileptikumsauf

dieMHD-Konzentration

Carbamazepin Abnahmeum0-22%(Zunahme

vonCarbamazepin-Epoxidum30

Abnahmeum40%

Clobazam nichtuntersucht keinEinfluss

Felbamat nichtuntersucht keinEinfluss

Lamotrigin leichteAbnahme* keinEinfluss

Phenobarbital Zunahmeum14-15% Abnahmeum30-31%

Phenytoin Zunahmeum0-40% Abnahmeum29-35%

Valproinsäure keinEinfluss Abnahmeum0-18%

*VorläufigeErgebnisseweisendaraufhin,dassOxcarbazepindieLamotrigin-Konzentrationsenken

kann,wasmöglicherweisebeiKindernvonBedeutungist.Allerdingsscheintdas

WechselwirkungspotentialvonOxcarbazepingeringerzuseinalsdasvongleichzeitig

verabreichtenEnzym-Induktoren(Carbamazepin,PhenobarbitonundPhenytoin).

Eswurdegezeigt,dassstarkeInduktorenderCytochrom-P450-Enzyme(d.h.Carbamazepin,

PhenytoinundPhenobarbiton)beiErwachsenendieMHD-Plasmakonzentrationenverringern(29-40

%).BeiKindernimAltervon4bis12JahrennahmdieMHD-Clearancebeigleichzeitiger

VerabreichungeinerderdreienzyminduzierendenAntiepileptikaimVergleichzurMonotherapieum

etwa35%zu.DiegemeinsameVerabreichungvonOxcarbazepinundLamotriginwarmiteinem

erhöhtenRisikofürunerwünschteEreignisse(Übelkeit,Somnolenz,Benommenheitund

Kopfschmerzen)verbunden.BeigleichzeitigerVerabreichungeinesodermehrereranderer

AntiepileptikamitOxcarbazepinistaufFall-zu-Fall-BasiseinesorgfältigeDosisanpassungund/oder

ÜberwachungderPlasmakonzentrationinBetrachtzuziehen.DiesgiltinsbesonderefürKinderund

Jugendliche,diegleichzeitigLamotriginerhalten.

UnterOxcarbazepinwurdekeineAutoinduktionbeobachtet.

SonstigeArzneimittel-Wechselwirkungen

Cimetidin,Erythromycin,Viloxazin,WarfarinundDextropropoxyphenhattenkeinenEinflussaufdie

PharmakokinetikvonMHD.

WegenderstrukturellenVerwandtschaftzwischenOxcarbazepinundtrizyklischenAntidepressiva

kannestheoretischzuWechselwirkungenzwischenOxcarbazepinundMonoaminooxidase(MAO)-

Hemmernkommen.

DieklinischenStudienschlossenauchPatientenein,dietrizyklischeAntidepressivaerhieltenundes

wurdenkeineklinischrelevantenWechselwirkungenbeobachtet.

DieKombinationausLithiumundOxcarbazepinkannzueinerverstärktenNeurotoxizitätführen.

4.6SchwangerschaftundStillzeit

de_29414 Seite7 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

Schwangerschaft

RisikoimZusammenhangmitderEpilepsieundmitAntiepileptikaimAllgemeinen:

Eswurdegezeigt,dassdiePrävalenzvonMissbildungenbeiKindernvonFrauenmitEpilepsiezwei-

bisdreimalhöheristalsdieRatevonetwa3%inderNormalbevölkerung.InderPopulationder

behandeltenschwangerenFrauenwurdeuntereinerPolytherapieeineZunahmevonMissbildungen

beobachtet.Allerdingswurdenichtuntersucht,inwelchemAusmaßdieBehandlungund/oderdie

Erkrankungverantwortlichsind.

DarüberhinausdarfeinewirksameantiepileptischeBehandlungnichtunterbrochenwerden,daeine

VerschlechterungderErkrankungsowohlfürdieMutteralsauchfürdenFetenschädlichist.

RisikoimZusammenhangmitOxcarbazepin:

DievorliegendenklinischenDatenzurExpositionwährendderSchwangerschaftlassennochkeine

BeurteilungdesteratogenenPotentialsvonOxcarbazepinzu.IntierexperimentellenStudienwurden

unterfürdasMuttertiertoxischenDoseneineerhöhteembryonaleMortalität,

WachstumsverzögerungenundMissbildungenbeobachtet(sieheAbschnitt5.3).

UnterBerücksichtigungdieserDatenergibtsich:

WenneinemitOxcarbazepinbehandelteFrauschwangerwirdodereineSchwangerschaftplant,

mussdieAnwendungdiesesArzneimittelssorgfältigneubewertetwerden.Esistdieniedrigste

wirksameDosiszuverabreichenundwannimmermöglichistzumindestindenerstendrei

SchwangerschaftsmonateneineMonotherapiezubevorzugen.

DiePatientinnensindüberdaserhöhteMissbildungs-Risikoaufzuklärenundsolltendie

MöglichkeitenzueinempränatalenScreeningerhalten.

EinewirksameantiepileptischeBehandlungmitOxcarbazepindarfinderSchwangerschaftnicht

unterbrochenwerden,daeineVerschlechterungderErkrankungsowohlfürdieMutteralsauchfür

denFetenschädlichist.

MonitoringundPrävention:

AntiepileptikakönneneinenFolsäuremangelbegünstigen,derwiederumzufetalenAnomalien

beitragenkann.EswirdeineFolsäure-SupplementierungvorundwährendderSchwangerschaft

empfohlen.DadieWirksamkeitdieserSupplementierungnichtnachgewiesenist,kannauchFrauen

mitFolsäure-SupplementierungeinespeziellepränataleDiagnostikangebotenwerden.

BeimNeugeborenen:

BeiNeugeborenenwurdendurchAntiepileptikaverursachteBlutungsstörungenbeobachtet.Als

präventiveMaßnahmesollteindenletztenWochenderSchwangerschaftundbeimNeugeborenen

VitaminK

gegebenwerden.

Stillzeit

OxcarbazepinundseinaktiverMetabolit(MHD)werdenbeimMenschenindieMuttermilch

ausgeschieden.BeibeidenSubstanzenwurdeeinMilch-Plasma-Konzentrationsverhältnisvon0,5

beobachtet.DieAuswirkungenaufeinüberdiesenWegmitOxcarbazepinexponiertesNeugeborenes

sindnichtbekannt.DahersollteOxcarbazepinnichtinderStillzeitangewendetwerden.

4.7AuswirkungenaufdieVerkehrstüchtigkeitunddieFähigkeitzumBedienenvonMaschinen

DieAnwendungvonOxcarbazepinwarmitNebenwirkungenwieBenommenheit/Schwindeloder

Somnolenzverbunden(sieheAbschnitt4.8).AusdiesemGrundsinddiePatientendarüber

aufzuklären,dassdiekörperlichenund/odergeistigenFähigkeiten,diezurBedienungvonMaschinen

oderzumAutofahrenerforderlichsind,beeinträchtigtseinkönnen.

de_29414 Seite8 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

4.8Nebenwirkungen

DieamhäufigstengenanntenNebenwirkungensindSchläfrigkeit,Kopfschmerzen,

Benommenheit/Schwindel,Diplopie,Übelkeit,ErbrechenundMüdigkeitundtretenbeimehrals10%

derPatientenauf.

DasProfilanunerwünschtenEreignissennachKörpersystemenbasiertaufdeninklinischenStudien

auftretendenunerwünschtenEreignissen,fürdieeinZusammenhangmitOxcarbazepinangegeben

wurde.DarüberhinauswurdenklinischrelevanteBerichtezuNebenwirkungenaus„Named-Patient“-

ProgrammenundausderPostmarketing-Erfahrungberücksichtigt.

BeidenHäufigkeitsangabenzuNebenwirkungenwerdenfolgendeKategorienzuGrundegelegt:sehr

häufig(≥1/10);häufig(≥1/100,<1/10);gelegentlich(≥1/1000,<1/100);selten(≥1/10000,<

1/1000);sehrselten(<1/10000),unbekannt(HäufigkeitaufGrundlagederverfügbarenDatennicht

abschätzbar).

ErkrankungendesBlutesunddesLymphsystems

gelegentlich Leukopenie

sehrselten Thrombopenie

nichtbekannt Knochenmarkdepression,aplastischeAnämie,

Agranulozytose,Panzytopenie,Neutropenie

ErkrankungendesImmunsystems

sehrselten Überempfindlichkeit(einschließlichMultiorgan-

Überempfindlichkeit),charakterisiertdurchMerkmale

wieHautausschlag,Fieber.FolgendeOrganeoder

Systemekönnenebenfallsbetroffensein:Blutund

Lymphsystem(z.B.Eosinophilie,Thrombopenie,

Leukopenie,Lymphadenopathie,Splenomegalie),Leber

(z.B.abweichendeLeberwerte,Hepatitis),Muskelnund

Gelenke(z.B.Gelenkschwellungen,Myalgien,

Arthralgien),Nervensystem(z.B.hepatische

Enzephalopathie),Niere(z.B.Proteinurie,interstitielle

Nephritis,Niereninsuffizienz),Lunge(z.B.Dyspnö,

Lungenödem,Asthma,Bronchospasmus,interstitielle

Lungenerkrankung),Angioödem

unbekannt anaphylaktischeReaktionen

Stoffwechsel-undErnährungsstörungen

häufig Hyponatriämie

sehrselten HyponatriämiemitBeschwerdenwieKrampfanfälle,

Verwirrtheit,Bewusstseinseinschränkung,

Enzephalopathie(weitereunerwünschteEreignisse

sieheauchErkrankungendesNervensystems),

Sehstörungen(z.B.verschwommenesSehen),

Erbrechen,Übelkeit †

PsychiatrischeErkrankungen

häufig Verwirrtheit,Depression,Apathie,Agitatiertheit(z.B.

Nervosität),emotionaleInstabilität

ErkrankungendesNervensystems

sehrhäufig Somnolenz,Kopfschmerzen,Benommenheit/Schwindel

häufig Ataxie,Tremor,Nystagmus,Störungender

de_29414 Seite9 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

Aufmerksamkeit,Amnesie

Augenerkrankungen

sehrhäufig Diplopie

häufig verschwommenesSehen,Sehstörungen

ErkrankungendesOhrsunddesLabyrinths

häufig Schwindel

Herzerkrankungen

sehrselten Arrhythmien,Atrioventrikularblock

Gefäßerkrankungen

unbekannt Hypertonie

ErkrankungendesGastrointestinaltrakts

sehrhäufig Übelkeit,Erbrechen

häufig Durchfall,Verstopfung,abdominelleSchmerzen

sehrselten Pankreatitisund/oderLipase-und/oderAmylase-

Anstiege

Leber-undGallenerkrankungen

sehrselten Hepatitis

ErkrankungenderHautunddesUnterhautzellgewebes

häufig Hautausschlag,Alopezie,Akne

gelegentlich Urtikaria

sehrselten Angioödem,Stevens-Johnson-Syndrom,toxische

epidermaleNekrolyse(Lyell-Syndrom),Erythema

multiforme(sieheAbschnitt4.4)

Sklelettmuskulatur-,Bindegewebs-undKnochenerkrankungen

sehrselten systemischerLupuserythematosus

allgemeineErkrankungenundBeschwerdenamVerabreichungsort

sehrhäufig Müdigkeit

häufig Asthenie

Untersuchungen

gelegentlich AnstiegderLeberenzyme,AnstiegderBlutspiegelder

alkalischenPhosphatase

InsehrseltenenFällenkanneswährendderAnwendungvonOxcarbazepinzueinerklinisch

relevantenHyponatriämie(Natrium<125mmol/l)kommen.DiesewirdimAllgemeineninden

ersten3Behandlungsmonatenbeobachtet,auchwennbeieinigenPatientenmehrals1Jahrnach

BehandlungsbeginnzumerstenMaleineNatrium-Serumkonzentration<125mmol/lfestgestellt

wurde(sieheAbschnitt4.4).

4.9Überdosierung

EswürdeüberEinzelfällemitÜberdosierungbeschrieben.DiemaximaleingenommeneDosisbetrug

etwa24000mg.AllePatientenerholtensichuntereinersymptomatischenBehandlung.Zuden

SymptomeneinerÜberdosierunggehörenSomnolenz,Benommenheit/Schwindel,Übelkeit,

Erbrechen,Hyperkinesie,Hyponatriämie,AtaxieundNystagmus.EsgibtkeinspezifischesAntidot.Es

sollteeinegeeignetesymptomatischeundsupportiveBehandlungdurchgeführtwerden.Eine

EliminationdesArzneimittelsdurcheineMagenspülungund/odereineInaktivierungdurchdie

VerabreichungvonAktivkohlesindinBetrachtzuziehen.

5. PHARMAKOLOGISCHEEIGENSCHAFTEN

de_29414 Seite10 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

5.1PharmakodynamischeEigenschaften

PharmakotherapeutischeGruppe:Carboxamid-Derivate

ATC-Code:N03AF02

PharmakodynamischeWirkungen

OxcarbazepinübtseinepharmakologischeWirkungüberwiegendüberseinenMetaboliten(MHD)aus

(sieheAbschnitt5.2).Eswirdangenommen,dassderWirkmechanismusvonOxcarbazepinundMHD

vorwiegendaufeinerBlockadederspannungsabhängigenNatrium-Kanäleberuht,diezueiner

StabilisierungübererregterNervenmembranen,HemmungrepetitiverneuronalerEntladungenund

VerminderungderAusbreitungvonsynaptischenImpulsenführt.Zusätzlichkönnenaucheineerhöhte

DurchlässigkeitderZellmembranfürKaliumundeineModulationvondurchhoheSpannungen

aktiviertenCalcium-KanälenzuderantikonvulsivenWirkungbeitragen.Eswurdenkeinerelevanten

InteraktionenmitNeurotransmitter-oderModulator-RezeptorenimGehirnbeobachtet.

OxcarbazepinundseinaktiverMetabolit(MHD)sindbeiTierenpotenteundwirksame

Antikonvulsiva.SieschütztenNagervorgeneralisiertentonisch-klonischenund,ingeringeremMaße,

klonischenKrampfanfällenundverringertenbeiRhesus-AffenmitAluminiumimplantatendie

HäufigkeitchronischrezidivierenderpartiellerAnfälleodereliminiertenderartigeAnfälle.BeiMäusen

undRattenwurdewährendeiner5-tägigenbzw.4-wöchigentäglichenBehandlungmitOxcarbazepin

oderMHDkeineToleranzentwicklung(d.h.AbschwächungderantikonvulsivenWirksamkeit)in

Bezugauftonisch-klonischeAnfällebeobachtet.

5.2PharmakokinetischeEigenschaften

Resorption

OxcarbazepinwirdnachoralerVerabreichungvollständigresorbiertundumfangreichinseinen

pharmakologischwirksamenMetaboliten(MHD)verstoffwechselt.

NacheinmaligerVerabreichungvon600mgOxcarbazepinannüchternegesundemännliche

ProbandenbetrugdiemittlereC

vonMHD34μmol/lunddieentsprechendemedianet

4,5

Stunden.

IneinerStudiezurMassenbilanzbeimMenschenwarennur2%derimPlasmagemessenen

GesamtradioaktivitätaufunverändertesOxcarbazepin,etwa70%aufMHDundderRestaufweniger

bedeutendesekundäreMetabolitenzurückzuführen,dieschnelleliminiertwurden.

NahrunghatkeinenEinflussaufGeschwindigkeitundAusmaßderOxcarbazepin-Resorption,sodass

dasArzneimittelzuoderunabhängigvondenMahlzeiteneingenommenwerdenkann.

Verteilung

DasscheinbareVerteilungsvolumenvonMHDbeträgt49Liter.

Etwa40%vonMHDwerdenanSerumproteinegebundenundzwarvorwiegendanAlbumin.Die

BindungwarinnerhalbdertherapeutischrelevantenSpannevonderSerumkonzentrationunabhängig.

OxcarbazepinundMHDbindennichtanalpha-1-Acid-Glykoprotein.

OxcarbazepinundMHDpassierendiePlazenta.IneinemFallwarendieMHD-Plasmakonzentrationen

beiderMutterundbeimNeugeborenenvergleichbar.

Biotransformation

OxcarbazepinwirdinderLeberschnelldurchimCytosolbefindlicheEnzymezuMHDreduziert,das

vorwiegendfürdiepharmakologischeWirkungverantwortlichistundübereineKonjugationmit

Glucuronsäureweiterverstoffwechseltwird.KleineMengen(4%derDosis)werdenzum

pharmakologischinaktivenMetaboliten(10,11-Dihydroxy-Derivat,DHD)oxidiert.

Elimination

de_29414 Seite11 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

OxcarbazepinwirdvorwiegendinFormvonMetabolitenausdemKörpereliminiert,diezumgrößten

TeilüberdieNierenausgeschiedenwerden.Mehrals95%derDosistretenimUrinauf,davon

wenigerals1%alsunverändertesOxcarbazepin.DieExkretionimStuhlmachtwenigerals4%der

verabreichtenDosisaus.Etwa80%derDosiswerdenimUrinentwederinFormvonMHD-

Glucuroniden(49%)oderalsunverändertesMHD(27%)ausgeschieden,währenddasinaktiveDHD

etwa3%undOxcarbazepin-Konjugateetwa13%derDosisausmachen.

OxcarbazepinwirdmiteinerscheinbarenHalbwertszeitvon1,3bis2,3Stundenschnellausdem

Plasmaeliminiert.ImGegensatzdazubeträgtdiescheinbarePlasmahalbwertszeitvonMHD

durchschnittlich9,3±1,8h.

Dosisproportionalität

DieSteady-State-PlasmakonzentrationenvonMHDwerdenbeizweimaltäglicherVerabreichungvon

OxcarbazepinanPatienteninnerhalbvon2-3Tagenerreicht.MHDhatimSteady-Stateeinelineare

Pharmakokinetik,dieüberdieDosisspannevon300bis2400mg/Tagdosisproportionalist.

BesonderePatientengruppen

PatientenmiteingeschränkterLeberfunktion

EswurdenPharmakokinetikundMetabolismusvonOxcarbazepinundMHDnacheineroralen900

mg-EinzeldosisbeigesundenProbandenundPatientenmiteingeschränkterLeberfunktionuntersucht.

EineleichtebismittelschwereEinschränkungderLeberfunktionhattekeinenEinflussaufdie

PharmakokinetikvonOxcarbazepinundMHD.OxcarbazepinwurdenichtbeiPatientenmitschwerer

EinschränkungderLeberfunktionuntersucht.

PatientenmiteingeschränkterNierenfunktion

EsbestehteinelineareKorrelationzwischenderCreatinin-ClearanceundderrenalenClearancevon

MHD.NachVerabreichungeinerOxcarbazepin-Einzeldosiszu300mgistdie

EliminationshalbwertszeitvonMHDbeiPatientenmiteingeschränkterNierenfunktion(Creatinin-

Clearance<30ml/min)imVergleichzuPatientenmitnormalerNierenfunktion(10Stunden)um60-

90%verlängert(16bis19Stunden)unddieAUCaufdasDoppelteerhöht.

Kinder

DiePharmakokinetikvonOxcarbazepinwurdeinklinischenStudienanKindernundJugendlichen

untersucht,dieDosenvon10-60mg/kg/Tagerhielten.DiegewichtsadjustierteMHD-Clearancenimmt

mitzunehmendemAlterundAnnäherungdesKörpergewichtsandasGewichtErwachsenerab.Die

mittleregewichtsadjustierteClearanceistbeiKindernimAltervon4bis12Jahrenetwa40%höher

alsbeiErwachsenen.Daherwirderwartet,dassdieExpositionbeidiesenKindernbeiBehandlungmit

einervergleichbarengewichtsadjustiertenDosisetwazweiDrittelderExpositionvonErwachsenen

beträgt.Mannimmtan,dassdiegewichtsadjustierteMHD-ClearancebeiKindernimAltervon13

JahrenunddarübermitdemzunehmendemKörpergewichtdenWertvonErwachsenenerreicht.

ÄlterePatienten

NachVerabreichungeinereinzelnen(300mg)odermehrererOxcarbazepin-Dosen(600mg/Tag)an

älterePatienten(60-82Jahre)warendiemaximalePlasmakonzentrationunddieAUCvonMHDum

30-60%höheralsbeijüngerenProbanden(18-32Jahre).VergleichederCreatinin-Clearancebei

jungenundälterenProbandenweisendaraufhin,dassderUnterschiedaufeinealtersabhängige

ReduktionderCreatinin-Clearancezurückzuführenwar.DadietherapeutischeDosisindividuell

angepasstwird,sindkeinebesonderenDosierungsempfehlungenerforderlich.

Geschlecht

WederbeiKindernnochbeiErwachsenenoderälterenPatientenwurdengeschlechtsabhängige

pharmakokinetischeUnterschiedebeobachtet.

de_29414 Seite12 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

5.3PräklinischeDatenzurSicherheit

BasierendaufdenkonventionellenStudienzurSicherheitspharmakologie,Toxizitätbeiwiederholter

GabeundGentoxizitätvonOxcarbazepinunddempharmakologischaktivenMetaboliten,

Monohydroxy-Derivat(MHD),lassendiepräklinischenDatenkeinebesonderenGefahrenfürden

Menschenerkennen.

InStudienzurToxizitätbeiwiederholterGabewurdenbeiRattenHinweiseaufeineNephrotoxizität

gefunden,nichtaberbeiHundenoderMäusen.EsliegenkeineBerichtezuderartigenVeränderungen

beiPatientenvor,sodassdieklinischeRelevanzderBefundebeiderRatteunbekanntist.

UntersuchungenzurImmunstimulationanMäusenzeigten,dassMHD(undingeringeremAusmaß

auchOxcarbazepin)eineverzögerteÜberempfindlichkeitsreaktionhervorrufenkann.

IntierexperimentellenStudienergabensichaufeinemfürdasMuttertiertoxischenDosisniveau

BefundewieeineZunahmederembryonalenMortalitätundeinegewisseVerzögerungdespränatalen

und/oderpostnatalenWachstums.

IneinerderachtStudienzurEmbryotoxizität,dieentwedermitOxcarbazepinodermitdem

pharmakologischwirksamenMetaboliten(MHD)durchgeführtwurden,warbeiRattenunterDosen,

beidenenebenfallseineToxizitätbeimMuttertierzubeobachtenwar,eineZunahmevonfetalen

Missbildungenfestzustellen(sieheAbschnitt4.6).

IndenStudienzurKanzerogenitätwurdenbeidenbehandeltenTierenLebertumoren(Rattenund

Mäuse),HodentumorenundGranularzelltumorendesweiblichenGenitaltrakts(Ratte)induziert.Das

AuftretenvonLebertumorenwarsehrwahrscheinlichFolgederInduktionhepatischermikrosomaler

Enzyme.DieseinduktiveWirkungistbeimitOxcarbazepinbehandeltenPatientennurschwach

ausgeprägtoderfehlt,kannabernichtganzausgeschlossenwerden.DieHodentumorenkönntendurch

erhöhteKonzentrationenanluteinisierendemHormoninduziertwordensein.DabeimMenschenkein

derartigerKonzentrationsanstiegzubeobachtenist,wirddiesenTumorenkeineklinischeRelevanz

zugesprochen.InderStudiezurKanzerogenitätvonMHDanRattenwurdeeindosisabhängiger

AnstiegderInzidenzvonGranularzelltumorendesweiblichenGenitaltrakts(ZervixundVagina)

festgestellt.DieseEffektetratenbeieinemExpositionsniveauauf,dasdemdererwartetenklinischen

Expositionentsprach.DerMechanismusfürdasAuftretendieserTumorenwurdenochnicht

aufgeklärt.DaheristdieklinischeRelevanzdieserTumorenunbekannt.

6. PHARMAZEUTISCHEANGABEN

6.1ListedersonstigenBestandteile

Tablettenkern

Lactose-Monohydrat

Maisstärke

Crospovidon(TypA)

Povidon(K30)

mikrokristallineCellulose

Carboxymethylstärke-Natrium(TypA)

hochdispersesSiliciumdioxid

Magnesiumstearat

Filmüberzug

Hypromellose

Macrogol6000

Macrogol400

de_29414 Seite13 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

Titandioxid(E171)

Eisen(III)-hydroxid-oxidxH

O(E172)

GelborangeS,Aluminiumsalz(E110)

6.2Inkompatibilitäten

Nichtzutreffend.

6.3DauerderHaltbarkeit

3Jahre

6.4BesondereVorsichtsmaßnahmenfürdieAufbewahrung

FürdieseArzneimittelsindkeinebesonderenLagerungsbedingungenerforderlich.

6.5ArtundInhaltdesBehältnisses

TransparentePVC/PVdC-Aluminium-Blisterpackungen:

OxcarbazepinTeva150mgFilmtabletten

BlisterpackungeninPackungenmit50,100oder200Filmtabletten.

OxcarbazepinTeva300mgFilmtabletten

BlisterpackungeninPackungenmit50,100oder200Filmtabletten.

OxcarbazepinTeva600mgFilmtabletten

BlisterpackungeninPackungenmit50,100oder200Filmtabletten.

6.6BesondereVorsichtsmaßnahmenfürdieBeseitigung

KeinebesonderenAnforderungen.

7. INHABERDERZULASSUNGEN

TEVAGmbH

Wasastraße50

01445Radebeul

8. ZULASSUNGSNUMMERN

71734.00.00

71735.00.00

71736.00.00

9. DATUMDERERTEILUNGDERZULASSUNGEN

16.06.2010

de_29414 Seite14 Version v. 05.08.10

Fachinformation

(Zusammenfassungder Merkmale desArzneimittels/SPC)

TEVAGmbH OxcarbazepinTeva ®

Stand:September2010

10.STANDDERINFORMATION

September2010

11.VERKAUFSABGRENZUNG

Verschreibungspflichtig

de_29414 Seite15 Version v. 05.08.10

Ähnliche Produkte

Suchen Sie nach Benachrichtigungen zu diesem Produkt

Teilen Sie diese Informationen