Arplexam 2,5 mg/ 0,625 mg/5 mg Filmtablettten

Österreich - Deutsch - AGES (Agentur für Gesundheit und Ernährungssicherheit)

Kaufe es jetzt

Gebrauchsinformation Gebrauchsinformation (PIL)

31-01-2017

Fachinformation Fachinformation (SPC)

31-01-2017

Wirkstoff:
AMLODIPIN BESILAT; INDAPAMID; PERINDOPRIL ARGININ
Verfügbar ab:
Les Laboratoires Servier
ATC-Code:
C09BX01
INN (Internationale Bezeichnung):
AMLODIPINE BESYLATE; INDAPAMIDE; PERINDOPRIL ARGININE
Verschreibungstyp:
Arzneimittel zur wiederholten Abgabe gegen aerztliche Verschreibung
Produktbesonderheiten:
Abgabe durch eine (öffentliche) Apotheke
Zulassungsnummer:
135514
Berechtigungsdatum:
2014-04-09

PACKUNGSBEILAGE

Gebrauchsinformation:InformationfürPatienten

Arplexam2,5mg/0,625mg/5mgFilmtabletten

Arplexam5mg/1,25mg/5mgFilmtabletten

Arplexam5mg/1,25mg/10mgFilmtabletten

Wirkstoffe:Perindopril-Arginin/Indapamid/Amlodipin

LesenSiediegesamtePackungsbeilagesorgfältigdurch,bevorSiemitderEinnahmedieses

Arzneimittelsbeginnen,dennsieenthältwichtigeInformationen.

HebenSiediePackungsbeilageauf.VielleichtmöchtenSiediesespäternochmalslesen.

WennSieweitereFragenhaben,wendenSiesichanIhrenArztoderApotheker.

DiesesArzneimittelwurdeIhnenpersönlichverschrieben.GebenSieesnichtanDritteweiter.

EskannanderenMenschenschaden,auchwenndiesediegleichenBeschwerdenhabenwieSie.

WennSieNebenwirkungenbemerken,wendenSiesichanIhrenArzt,Apothekeroderdas

medizinischeFachpersonal.DiesgiltauchfürNebenwirkungen,dienichtindieser

Packungsbeilageangegebensind.SieheAbschnitt4.

WasindieserPackungsbeilagesteht

WasistArplexamundwofürwirdesangewendet?

WassolltenSievorderEinnahmevonArplexambeachten?

WieistArplexameinzunehmen?

WelcheNebenwirkungensindmöglich?

WieistArplexamaufzubewahren?

InhaltderPackungundweitereInformationen

1. WasistArplexamundwofürwirdesangewendet?

ArplexamisteineKombinationausdreiWirkstoffen:Perindopril,IndapamidundAmlodipin.Esist

einblutdrucksenkendesArzneimittelundwirdzurBehandlungvonBluthochdruck(Hypertonie)

angewendet.

Patienten,diebereitseinKombinationspräparatausPerindoprilundIndapamidzusammenmit

AmlodipininFormeinesMonopräparateseinnehmen,könnenstattdesseneineTablettevonArplexam

verabreichtbekommen,diediedreiWirkstoffeindergleichenStärkeenthält.

Alle3WirkstoffetragenzurSenkungIhresBlutdruckesbeiundsiewirkengemeinsam,umIhren

BlutdruckunterKontrollezuhalten:

PerindoprilgehörtzueinerGruppevonWirkstoffen,dieAngiotensin-Converting-Enzyme(ACE)-

Hemmergenanntwird.EswirktdurcheineErweiterungderBlutgefäße,wodurchesfürIhrHerz

einfacherwird,BlutdurchdieGefäßezupumpen.

IndapamidisteinDiuretikum(daszueinerKlassevonArzneimittelngehört,die

SulfonamidderivatemiteinemIndolringgenanntwerden).DiuretikaerhöhendiedurchdieNieren

produzierteHarnmenge.IndapamidunterscheidetsichjedochinsofernvonanderenDiuretika,als

esnureineleichteErhöhungderproduziertenHarnmengebewirkt.

AmlodipinisteinCalciumkanalblocker(welcherderArzneimittelklassederDihydropyridine

zugeordnetist).Eswirkt,indemerdieBlutgefäßeentspannt,wodurchdasBlutleichter

hindurchströmenkann.

2. WassolltenSievorderEinnahmevonArplexambeachten?

Arplexamdarfnichteingenommenwerden,

-wennSieallergischgegenPerindopriloderandereACE-Hemmer,Indapamidoderandere

Sulfonamide,AmlodipinoderandereDihydropyridineodereinenderinAbschnitt6.genannten

sonstigenBestandteilediesesArzneimittelssind.

-wennSiewährendeinerfrüherenBehandlungmitACE-HemmernSymptomewieKeuchen,

SchwellungvonGesichtoderZunge,starkemJuckreizoderschwereHautausschlägefestgestellt

habenoderwenndieseSymptomebeiIhnenodereinemIhrerFamilienmitgliederunteranderen

Umständenaufgetretensind(einZustand,derAngioödemgenanntwird).

-wennSieaneinerschwerenLeberfunktionsstörungleidenoderandenSymptomender

sogenanntenhepatischenEnzephalopathie(einedegenerativeGehirnerkrankungverursachtdurch

eineLebererkrankung).

-wennbeiIhnenderVerdachtaufunbehandeltedekompensierteHerzinsuffizienzbesteht(schweres

Wasserlassen,Atembeschwerden).

-wennSieanderealsantiarrhythmischeArzneimitteleinnehmen,dielebensbedrohlichen

unregelmäßigenHerzschlag(Torsadesdepointes)verursachen.

-wennSieaneinerVerengungderAortenklappe(Aortenstenose)oderaneinemkardiogenen

Schockleiden(einZustand,indemIhrHerzdenKörpernichtmitgenügendBlutversorgenkann).

-wennSieanHerzinsuffizienznacheinemHerzinfarktleiden

-wennSieeinensehrniedrigenBlutdruck(Hypotonie)haben.

-wennSieeinenniedrigenKaliumspiegelimBlutaufweisen.

-wennSieaneinerschwerenNierenfunktionsstörungleiden.

-wennSieDialyseerhalten.

-wennSieaneinermittelschwerenNierenfunktionsstörungleiden(fürArplexam-Dosenmit

10mg/2,5mg/5mgund10mg/2,5mg/10mg).

-wennSielängerals3Monateschwangersind(esistbesserdieEinnahmevonArplexaminder

frühenSchwangerschaftzuvermeiden-sieheAbschnittSchwangerschaft).

-wennSiestillen.

-wennSieDiabetesmellitusodereineeingeschränkteNierenfunktionhabenundmiteinem

blutdrucksenkendenArzneimittel,dasAliskirenenthält,behandeltwerden.

DieAnwendungvonArplexamkannbeiDopingkontrollenzupositivenErgebnissenführen.

WarnhinweiseundVorsichtsmaßnahmen

BittesprechenSiemitIhremArztoderApotheker,bevorSieArplexameinnehmen,

wennSieaneinerhypertrophenKardiomyopathie(ErkrankungdesHerzmuskels)odereiner

Nierenarterienstenose(VerengungderArterie,diedieNieremitBlutversorgt)leiden.

wennSieanHerzinsuffizienzleidenoderandereHerzbeschwerdenhaben.

wennSieeinenstarkenBlutdruckanstieghaben(hypertensiveKrise).

wennSieLeberproblemehaben.

wennSieaneinerKollagenose(Hauterkrankung),wiesystemischemLupuserythematodesoder

Sklerodermie,leiden.

wennSieanArterioskleroseleiden(VerhärtungderArterien).

wennSiesicheinemTestunterziehenmüssen,umdieFunktionIhrerNebenschilddrüsezu

kontrollieren.

wennSieanGichtleiden.

wennSieDiabeteshaben.

wennSieeinesalzarmeDiäteinhaltenoderkaliumhaltigenSalzersatzverwenden(ein

ausgewogenerKaliumspiegelimBlutistbesonderswichtig).

wennSieLithiumoderKalium-sparendeDiuretika(Spironolacton,Triamteren)einnehmen,da

derenAnwendungmitArplexamzuvermeidenist(siehe„EinnahmevonArplexamzusammenmit

anderenArzneimitteln“).

wennSieschonältersindundIhreDosiserhöhtwerdenmuss.

wennbeiIhnenLichtempfindlichkeitsreaktionenauftraten.

wennSieeineschwarzeHautfarbehaben,habenSiemöglicherweiseeinhöheresRisikofür

Angioödem(SchwellungvonGesicht,Lippen,Mund,ZungeoderRachen,wasSchluck-oder

Atembeschwerdenverursachenkann)undeinegeringereblutdrucksenkendeWirkung.

wennSieHämodialysepatientsindundmitHigh-Flux-Membranendialysiertwerden.

wennSieNierenproblemehaben.

wennderSäuregehaltinIhremBlutzuhochist,wodurchdieAtemfrequenzansteigenkann.

wennSieDurchblutungsstörungenimGehirnhaben(niedrigerBlutdruckimGehirn).

wennSieeineSchwellungvonGesicht,Lippen,Mund,ZungeoderRachenfeststellen,was

Schluck-oderAtembeschwerdenverursachenkann(Angioödem),waswährendderBehandlung

jederzeiteintretenkann,wendenSiesichanIhrenArzt.

wennSieeinesderfolgendenArzneimittelzurBehandlungvonhohemBlutdruckeinnehmen:

-einenAngiotensin-II-Rezeptor-Antagonisten(diesewerdenauchalsSartanebezeichnet-z.B.

Valsartan,Telmisartan,Irbesartan),insbesonderewennSieNierenproblemeaufgrundvon

Diabetesmellitushaben.

Aliskiren.

IhrArztwirdgegebenenfallsIhreNierenfunktion,IhrenBlutdruckunddieElektrolytwerte(z.B.

Kalium)inIhremBlutinregelmäßigenAbständenüberprüfen.

SieheauchAbschnitt„Arplexamdarfnichteingenommenwerden“.

IhrArztwirdmöglicherweiseBluttestsanordnen,umniedrigeNatrium-oderKaliumwerteoderhohe

Calciumwertefestzustellen.

SiemüssenIhrenArztinformieren,wennSieeineSchwangerschaftvermuten(oderwennSie

schwangerwerdenkönnten).DieEinnahmevonArplexaminderfrühenSchwangerschaftwirdnicht

empfohlen.DiesesArzneimitteldarfnachdemdrittenSchwangerschaftsmonatnichteingenommen

werden,daesIhremKindindiesemEntwicklungsstadiumernsthaftschadenkönnte.(sieheAbschnitt

„SchwangerschaftundStillzeit“).

WennSieArplexameinnehmen,solltenSieIhrenArztauchinformieren,

wennSieeineNarkoseerhaltenund/oderoperiertwerden.

wennSievorKurzemanDurchfalloderErbrechengelittenhabenoderdehydriertsind.

wennSiesicheinerDialyseoderLDL-Aphereseunterziehenmüssen(maschinelleEntfernung

vonCholesterinausIhremBlut).

wennSieeineDesensibilisierungsbehandlungerhalten,umdieallergischenReaktionenbei

Bienen-oderWespensticheeinzuschränken.

wennSiesicheinerUntersuchungunterziehenmüssen,beidereinjodhältigesKontrastmittel

(eineSubstanz,dieOrganewieNierenoderMagenaufRöntgenaufnahmensichtbarmacht)

injiziertwerdenmuss.

KinderundJugendliche

ArplexamdarfKindernundJugendlichennichtverabreichtwerden.

EinnahmevonArplexamzusammenmitanderenArzneimitteln

InformierenSieIhrenArztoderApotheker,wennSieandereArzneimitteleinnehmen/anwenden,

kürzlichandereArzneimitteleingenommen/angewendethabenoderbeabsichtigen,andere

Arzneimitteleinzunehmen/anzuwenden.

NehmenSieAliskirennichtein(zurBehandlungvonBluthochdruck)wennSieDiabetesoder

Nierenproblemehaben.

Siesolltenesvermeiden,ArplexamzusammenmitfolgendenArzneimittelneinzunehmen:

Lithium(zurBehandlungbestimmterpsychischerErkrankungenwieManien,manisch-depressive

ErkrankungenundwiederholtauftretendeDepressionen)

Kalium-sparendeArzneimittel(z.B.Triamteren,Amilorid),Kaliumergänzungsmitteloder

kaliumhaltigerSalzersatz

Dantrolen(Infusion)wirdauchzurBehandlungmalignerHyperthermiewährendeinerNarkose

angewendet(dieSymptomeumfassensehrhohesFieberundMuskelsteifheit),

Estramustin(angewendetinderKrebstherapie),

AndereArzneimittelzurBehandlungvonhohemBlutdruck:Angiotensin-Converting-Enzyme

HemmerundAngiotensin-RezeptorBlocker.

DieBehandlungmitArplexamkanndurchandereArzneimittelbeeinflusstwerden.IhrArztmuss

unterUmständenIhreDosierunganpassenund/odersonstigeVorsichtsmaßnahmentreffen.

InformierenSieaufjedenFallIhrenArzt,wennSieeinesderfolgendenArzneimitteleinnehmen,da

hierbesondereVorsichterforderlichseinkann:

andereblutdrucksenkendeMedikamente,inklusiveAngiotensin-II-Rezeptor-Antagonistenoder

Aliskiren(sieheauchAbschnitte„Arplexamdarfnichteingenommenwerden"und

„WarnhinweiseundVorsichtsmaßnahmen“),oderDiuretika(erhöhendieHarnmenge,dievonden

Nierenproduziertwird)einnehmen,

Kalium-sparendeArzneimittelzurBehandlungvonHerzinsuffizienz:Eplerenonund

SpironolactoninDosenzwischen12,5mgund50mgtäglich,

Anästhetika,

jodhältigeKontrastmittel,

Bepridil(zurBehandlungvonAnginapectoris),

Moxifloxacin,Sparfloxacin(Antibiotika:ArzneimittelzurBehandlungvonInfektionen),

Methadon(zurBehandlungeinerAbhängigkeit),

Dofetilid,Ibutilid,Bretylium,Cisaprid,Diphemanil,Procainamid,Chinidin,Hydrochinidin,

Disopyramid,Amiodaron,Sotalol(zurBehandlungvonunregelmäßigemHerzschlag),

Verapamil,Diltiazem(ArzneimittelzurBehandlungvonHerzerkrankungen),

DigoxinoderandereHerzglykoside(zurBehandlungvonHerzproblemen),

bestimmteAntibiotikazurBehandlungvonInfektionen,wieRifampicin,Erythromycin,

Clarithromycin,

Itraconazol,Ketoconazol,injiziertesAmphotericinB(zurBehandlungvonPilzinfektionen),

Allopurinol(zurBehandlungvonGicht),

Mizolastin,TerfenadinoderAstemizol(AntihistaminikabeiHeuschnupfenoderAllergien),

KortikosteroidezurBehandlungverschiedenerErkrankungenwieschweresAsthmaund

rheumatoideArthritis,undnicht-steroidaleEntzündungshemmer(z.B.Ibuprofen)oderhohe

DosenSalicylate(z.B.Aspirin),

ImmunsuppressivazurBehandlungvonAutoimmunerkrankungenodernacheiner

Organtransplantation(z.B.Ciclosporin,Tacrolimus),

Tetracosactid(zurBehandlungvonMorbusCrohn),

Goldsalze,insbesonderebeiintravenöserVerabreichung(zurBehandlungvonSymptomen

rheumatoiderArthritis),

Halofantrin(zurBehandlungbestimmterArtenvonMalaria),

BaclofenzurBehandlungvonMuskelsteifheitbeiErkrankungenwiemultipleSklerose,

ArzneimittelzurBehandlungvonDiabetes,wieInsulinoderMetformin,

CalciumundCalciumergänzungsmittel,

stimulierendeAbführmittel(z.B.Senna),

ArzneimittelzurBehandlungvonKrebs,

Vincamin(zurBehandlungsymptomatischerkognitiverStörungenbeiälterenPersonen,

einschließlichGedächtnisverlusts),

ArzneimittelzurBehandlungvonpsychischenErkrankungenwieDepression,Angst,

Schizophrenieusw.(z.B.trizyklischeAntidepressiva,Antipsychotika,imipraminähnliche

AntidepressivaNeuroleptika),

Pentamidin(zurBehandlungvonLungenentzündung),

Ritonavir,Indinavir,Nelfinavir(sogenannteProtease-HemmerzurBehandlungvonHIV),

Hypericumperforatum(Johanniskraut),

Trimethoprim(zurBehandlungvonInfektionen),

Heparin(ArzneimittelzurBlutverdünnung)

ArzneimittelzurBehandlungvonniedrigemBlutdruck,SchockoderAsthma(z.B.Ephedrin,

NoradrenalinoderAdrenalin).

NitroglycerinundandereNitratenoderandereVasodilatoren,diezueinemweiterenAbsinkendes

Blutdrucksführenkönnen.

EinnahmevonArplexamzusammenmitNahrungsmittelnundGetränken

Personen,dieArplexameinnehmen,solltenkeinenGrapefruitsafttrinkenundkeineGrapefruitsessen.

GrapefruitsundGrapefruitsaftkönnennämlichzueinemAnstiegderBlutwertedesWirkstoffs

Amlodipinführen,waseineunvorhersehbareVerstärkungderblutdrucksenkendenWirkungvon

Arplexamverursachenkann.

SchwangerschaftundStillzeit

WennSieschwangersindoderstillen,oderwennSievermuten,schwangerzuseinoderbeabsichtigen,

schwangerzuwerden,fragenSievorderEinnahmediesesArzneimittelsIhrenArztoderApotheker

umRat.

Schwangerschaft

SiemüssenIhrenArztinformieren,wennSieeineSchwangerschaftvermuten(oderwennSie

schwangerwerdenkönnten).

InderRegelwirdIhnenIhrArztempfehlen,Arplexamnichtlängereinzunehmen.WennSieeine

SchwangerschaftplanenodersobaldSiewissen,dassSieschwangersindwirdIhrArztIhnenanstelle

vonArplexameinanderesArzneimittelempfehlen.ArplexamwirdinderfrühenSchwangerschaft

nichtempfohlenunddarfnichteingenommenwerden,wennSielängerals3Monateschwangersind,

daesIhremKindindiesemEntwicklungsstadiumernsthaftschadenkönnte.

Stillzeit

InformierenSieIhrenArztwennSiestillenoderstillenmöchten.ArplexamwirdfürstillendeMütter

nichtempfohlenundIhrArztwirdmöglicherweiseeineandereBehandlungfürSiewählen,wennSie

stillenmöchten,insbesonderedann,wennIhrKindneugeborenoderzufrühgeborenwurde.

VerkehrstüchtigkeitundFähigkeitzumBedienenvonMaschinen

Achtung:diesesArzneimittelkanndieReaktionsfähigkeitundVerkehrstüchtigkeit

beeinträchtigen!

ArplexamkannIhreFähigkeit,einFahrzeugzuführenundMaschinenzubedienen,beeinträchtigen.

WenndieTablettenbeiIhnenÜbelkeit,Schwindel,MüdigkeitoderKopfschmerzenverursachen,

dürfenSiekeineFahrzeugeführenoderMaschinenbedienen.WendenSiesichindiesemFallsofortan

IhrenArzt.

3. WieistArplexameinzunehmen?

NehmenSiediesesArzneimittelimmergenaunachAnweisungIhresArztesoderApothekersein.

FragenSiebeiIhremArztoderApothekernach,wennSiesichnichtsichersind.

SchluckenSiedieTablettemiteinemGlasWasserbevorzugtmorgensundvoreinerMahlzeit.Ihr

ArztwirddiefürSierichtigeDosisbestimmen.DaswirdnormalerweiseeineTabletteproTagsein.

WennSieeinegrößereMengevonArplexameingenommenhaben,alsSiesollten

WennSiezuvieleTabletteneinnehmen,kannIhrBlutdrucksehrniedrigodersogargefährlichniedrig

werden,wasgelegentlichmitÜbelkeit,Erbrechen,Krämpfen,Schwindel,Schläfrigkeit,geistiger

Verwirrtheit,Oligurie(eswirdwenigerHarnalsnormalausgeschieden),Anurie(eswirdkeinHarn

produziertoderausgeschieden)verbundenseinkann.Siefühlensichmöglicherweisebenommen,

kraftlosoderschwach.WennderBlutdruckabfallzustarkist,könnenSieeinenSchockerleiden.Ihre

HautfühltsichkaltundfeuchtanundSiekönntendasBewusstseinverlieren.WendenSiesichsofort

aneinenArzt,wennSiezuvieleArplexamTabletteneingenommenhaben.

WennSiedieEinnahmevonArplexamvergessenhaben

Esistwichtig,IhrArzneimitteltäglicheinzunehmen,daeineregelmäßigeBehandlungwirkungsvoller

ist.WennSiejedochvergessenhabeneineDosisArplexameinzunehmen,nehmenSiediefolgende

DosiszurgewohntenZeitein.NehmenSienichtdiedoppelteMengeein,wennSiedievorherige

Einnahmevergessenhaben.

WennSiedieEinnahmevonArplexamabbrechen

DadieBehandlungvonBluthochdrucküblicherweiseeinLebenlangandauert,müssenSiemitIhrem

Arztsprechen,bevorSiediesesArzneimittelabsetzen.

WennSieweitereFragenzurEinnahmediesesArzneimittelshaben,wendenSiesichanIhrenArzt

oderApotheker.

4. WelcheNebenwirkungensindmöglich?

WiealleArzneimittelkannauchdiesesArzneimittelNebenwirkungenhaben,dieabernichtbeijedem

auftretenmüssen.

WenneinederfolgendenNebenwirkungenbeiIhnenauftritt,nehmenSiedasArzneimittelnicht

längereinundinformierenSiesofortIhrenArzt:

PlötzlichesKeuchenbeimAtmen,SchmerzeninderBrust,Kurzatmigkeitoder

Atembeschwerden(gelegentlich)(kannbiszu1von100Personenbetreffen)

SchwellungderAugenlider,desGesichtsoderderLippen(gelegentlich)(kannbiszu1von

100Personenbetreffen)

SchwellungvonMund,ZungeundRachen,wasstarkeAtembeschwerdenverursacht

(gelegentlich)(kannbiszu1von100Personenbetreffen)

schwereHautreaktionen,einschließlichintensiverHautausschlag,Quaddeln,RötungderHaut

amganzenKörper,starkerJuckreiz,Blasenbildung,AbschälenundSchwellungderHaut,

EntzündungderSchleimhäute(Stevens-Johnson-Syndrom)oderandereallergische

Reaktionen(sehrselten)(kannbiszu1von10.000Personenbetreffen)

starkerSchwindeloderOhnmacht(häufig)(kannbiszu1von10Personenbetreffen)

Herzanfall(sehrselten)(kannbiszu1von10.000Personenbetreffen),lebensbedrohlicher

unregelmäßigerHerzschlag(Häufigkeitnichtbekannt)

EntzündungderBauchspeicheldrüse,diestarkeBauch-undRückenschmerzengemeinsammit

starkemUnwohlseinverursachenkann(sehrselten)(kannbiszu1von10.000Personen

betreffen)

GereihtnachabnehmenderHäufigkeitkönnenfolgendeNebenwirkungenauftreten:

Häufig(kannbiszu1von10Personenbetreffen):

Kopfschmerzen,Schwindel,Palpitationen(bewusstesWahrnehmendesHerzschlags),

Flush (Erröten mit Hitzegefühl), Drehschwindel, Kribbeln und Prickeln,

Sehverschlechterung,Tinnitus(Ohrengeräusche),Benommenheitaufgrundeinesniedrigen

Blutdruckes,Husten,Kurzatmigkeit,StörungenimMagen-Darm-Trakt(Übelkeit,

Erbrechen,Bauchschmerzen,Geschmacksstörungen,Mundtrockenheit,Verdauungsstörung

oder-problem,Durchfall,Verstopfung),allergischeReaktionen(wieHautausschläge,

Juckreiz),Krämpfe,Müdigkeit,Schläfrigkeit,SchwellungderKnöchel(Ödem)

Gelegentlich(kannbiszu1von100Personenbetreffen):

Stimmungsschwankungen,Angst,Depression,Schlafstörungen,Zittern,Quaddeln,

Ohnmacht,VerlustderSchmerzempfindung,Rhinitis(verstopfteoderlaufendeNase),

veränderterStuhlgang,Haarausfall,Purpura(kleinerotePunkteaufderHaut),Verfärbung

derHaut,juckendeHaut,Schwitzen,Brustschmerzen,Gelenk-oderMuskelschmerzen,

Rückenschmerzen,Schmerzen,Unwohlsein(Malaise),Nierenprobleme,Störungdes

Wasserlassens,vermehrterHarndrangnachts,häufigeresWasserlassen,Unfähigkeit,eine

Erektionzubekommen,FieberodererhöhteTemperatur,BeschwerdenoderVergrößerung

derBrüstebeimMann,Gewichtszu-oder-abnahme,AnstiegderAnzahlbestimmter

weißerBlutkörperchen,hoheKaliumwerteimBlut,Hypoglykämie(sehrniedriger

Blutzuckerspiegel),niedrigeNatriumwerteimBlut,Doppeltsehen,schnellerHerzschlag,

Vaskulitis(EntzündungderBlutgefäße),Lichtempfindlichkeitsreaktion(verändertes

AussehenderHaut)nachEinwirkungvonSonnen-oderkünstlichenUV-A-Strahlen,

AnsammlungvonBlasenaufderHaut,SchwellungvonHänden,KnöchelnoderFüßen,

KreatininspiegelimBluterhöhtundHarnsäurespiegelimBluterhöht,Stürze,

Mundtrockenheit.

Selten(kannbiszu1von1.000Personenbetreffen):

Verwirrtheit,VeränderungvonLaborparametern:erhöhteWertevonLeberenzymen,hohe

WertevonBilirubinimSerum.

Sehrselten(kannbiszu1von10.000Personenbetreffen):

SenkungderAnzahlweißerBlutkörperchen,SenkungderAnzahlvonBlutplättchen(was

vermehrteBlutergüsseundNasenblutenverursacht),Anämie(SenkungderAnzahlroter

Blutkörperchen),kardiovaskuläreStörungen(unregelmäßigerHerzschlag,Anginapectoris

(SchmerzeninBrust,KieferundRückennachkörperlicherAnstrengungundaufgrundvon

ProblemenmitdemBlutstromzumHerzen)),eosinophilePneumonie(eineselteneArtvon

Lungenentzündung),SchwellungdesZahnfleischs,schwereHautreaktionen,darunter

schwererHautausschlag,RötungderHautamgesamtenKörper,starkerJuckreiz,

Blasenbildung,AbschälenundSchwellungderHaut,Erythemamultiforme(ein

Hautausschlag,deroftmitrotenjuckendenFleckenimGesicht,anArmenoderBeinen

beginnt),Blutung,schmerzendesodergeschwollenesZahnfleisch,anormaleLeberfunktion,

Leberentzündung(Hepatitis),schwereNierenprobleme,GelbfärbungderHaut(Gelbsucht),

aufgeblähterBauch(Gastritis),StörungderNerven,wasSchwäche,Prickelnoder

Gefühllosigkeitverursachenkann,erhöhteMuskelspannung,Hyperglykämie(sehrhohe

Blutzuckerwerte),hoheCalciumwerteimBlut,Schlaganfallmöglicherweiseaufgrundeines

außergewöhnlichniedrigenBlutdrucks.

Nichtbekannt(HäufigkeitaufGrundlagederverfügbarenDatennichtabschätzbar):

hepatischeEnzephalopathie(degenerativeGehirnerkrankungverursachtdurcheine

Lebererkrankung),abnormaleEKGHerzüberwachung,niedrigerKaliumspiegelimBlut,

wennSieansystemischemLupuserythematodes(eineArtvonKollagenose)leiden,könnte

dieserschlimmerwerden.

Kurzsichtigkeit(Myopie),verschwommenesSehen.

FolgendeNebenwirkungenwurdenebenfallsberichtet:Störungen,diesichausSteifheit,

Zitternund/oderBewegungsstörungenzusammensetzen.

VeränderungenderLaborparameter(Bluttests)könnenvorkommen.IhrArztmussmöglicherweise

Bluttestsdurchführen,umIhreBehandlungzuüberwachen.

MeldungvonNebenwirkungen

WennSieNebenwirkungenbemerken,wendenSiesichanIhrenArzt,Apothekeroderdas

medizinischeFachpersonal.DiesgiltauchfürNebenwirkungen,dienichtindieser

Packungsbeilageangegebensind. SiekönnenNebenwirkungenauchdirektüberdasnationale

Meldesystemanzuzeigen:

BundesamtfürSicherheitimGesundheitswesen

Traisengasse5

1200WIEN

ÖSTERREICH

Fax:+43(0)5055536207

Website: http://www.basg.gv.at/

IndemSieNebenwirkungenmelden,könnenSiedazubeitragen,dassmehrInformationen

überdieSicherheitdiesesArzneimittelszurVerfügunggestelltwerden.

5. WieistArplexamaufzubewahren?

BewahrenSiediesesArzneimittelfürKinderunzugänglichauf.

SiedürfendiesesArzneimittelnachdemaufdemUmkartonunddemTablettenbehältnisangegebenen

Verfalldatumnichtmehrverwenden.DasVerfalldatumbeziehtsichaufdenletztenTagdes

angegebenenMonats.

FürdiesesArzneimittelsindkeinebesonderenLagerungsbedingungenerforderlich.

FürBehältnissemit30FilmtablettenbeträgtdieHaltbarkeitnachdemerstenÖffnen30Tage.

FürBehältnissemit100FilmtablettenbeträgtdieHaltbarkeitnachdemerstenÖffnen100Tage.

EntsorgenSieArzneimittelnichtimAbwasseroderHaushaltsabfall.FragenSieIhrenApotheker,wie

dasArzneimittelzuentsorgenist,wennSieesnichtmehrverwenden.SietragendamitzumSchutzder

Umweltbei.

6. InhaltderPackungundweitereInformationen

WasArplexamenthält

DieWirkstoffesind:Perindopril-Arginin,IndapamidundAmlodipin.

EineFilmtablettevonArplexam2,5mg/0,625mg/5mgenthält1,6975mgPerindopril

entsprechend2,5mgPerindopril-Arginin,0,625mgIndapamidund6,935mgAmlodipinbesilat

entsprechend5mgAmlodipin.

EineFilmtablettevonArplexam5/1,25/5mgenthält3,395mgPerindoprilentsprechend5mg

Perindopril-Arginin,1,25mgIndapamidund6,935mgAmlodipinbesilatentsprechend5mg

Amlodipin.

EineFilmtablettevonArplexam5/1,25/10mgenthält3,395mgPerindoprilentsprechend5mg

Perindopril-Arginin,1,25mgIndapamidund13,870mgAmlodipinbesilatentsprechend10mg

Amlodipin.

DiesonstigenBestandteilesind:

-Tablettenkern:Calciumcarbonat-Stärke-Verbindung:Calciumcarbonat90%,vorverkleisterte

Maisstärke10%,mikrokristallineCellulose(E460),Croscarmellose-Natrium(E468),

Magnesiumstearat(E572),hochdispersesSiliciumdioxid,vorverkleisterteStärke.

-Tablettenfilm:Glycerol(E422),Hypromellose6mPa.s(E464),Macrogol6000,

Magnesiumstearat(E572),Titandioxid(E171).

WieArplexamaussiehtundInhaltderPackung

Arplexam2,5/0,625/5mgTablettensindweiße,länglicheFilmtabletten,8,5mmlangund4,5mm

breit,mitderPrägung aufeinerSeiteundaufderanderenSeite.

Arplexam5/1,25/5mgsindweiße,länglicheFilmtabletten,9,75mmlangund5,16mmbreit,mitder

Prägung aufeinerSeiteundaufderanderenSeite.

Arplexam5/1,25/10mgsindweiße,länglicheFilmtabletten,10,7mmlangund5,66mmbreit,mitder

Prägung aufeinerSeiteund aufderanderenSeite.

DieTablettensindinSchachtelnmit10,30,60(2Tablettenbehältnissemit30),90(3

Tablettenbehältnissemit30),100und500(5Tablettenbehältnissemit100)erhältlich.

DasTrocknungsmittelistimStopferdesTablettenbehältnissesintegriert.

EswerdenmöglicherweisenichtallePackungsgrößenindenVerkehrgebracht.

PharmazeutischerUnternehmer:

LesLaboratoiresServier

50,rueCarnot

92284Suresnescedex-Frankreich

Hersteller:

Servier(Ireland)IndustriesLtd

GoreyRoad

Arklow-Co.Wicklow–Irland

LesLaboratoiresServierIndustrie

905routedeSaran

45520Gidy–France

AnpharmPrzedsiebiorstwoFarmaceutyczneS.A.

03-236Warszawa

ul.Annopol6b–Poland

EGISPharmaceuticalsPLC

H-9900Körmend,Mátyáskirályu.65

Hungary

Z.Nr.:

135514

135515

135516

DiesesArzneimittelistindenMitgliedsstaatendesEuropäischenWirtschaftsraumes(EWR)

unterdenfolgendenBezeichnungenzugelassen:

Belgien ARPLEXAM,comprimépelliculé

Bulgarien ARPLEXAM,филмиранитаблетки

Estland ARPLEXAM

Finnland ARPLEXAM,kalvopäällysteinentabletti

Frankreich ARPLEXAM,comprimépelliculé

Griechenland ARPLEXAM,επικαλυμμέναμελεπτόυμένιοδισκία

Irland ARPLEXAMfilm-coatedtablets

Italien TRIPLINOR,compresserivestiteconfilm

Lettland ARPLEXAM,apvalkotāstabletes

Litauen ARPLEXAM,plėveledengtostabletės

Luxemburg ARPLEXAM,comprimépelliculé

Niederlande ARPLEXAM,filmomhuldetabletten

Österreich ARPLEXAM,Filmtabletten

Portugal ARPLEXAM

Rumänien ARPLEXAMcomprimatefilmate

Slowakei ARPLEXAM,filmomobalenétablety

Spanien ARPLEXAMcomprimidosrecubiertosconpelícula

TschechischeRepublik ARPLEXAM,potahovanétablety

Ungarn COVERCARDPLUSfilmtabletták

DiesePackungsbeilagewurdezuletztüberarbeitetimSeptember2015.

Document Outline

ZUSAMMENFASSUNGDERMERKMALEDESARZNEIMITTELS

1. BEZEICHNUNGDESARZNEIMITTELS

Arplexam2,5mg/0,625mg/5mgFilmtabletten

[Arplexam5mg/1,25mg/5mgFilmtabletten]

[Arplexam5mg/1,25mg/10mgFilmtabletten]

2. QUALITATIVEUNDQUANTITATIVEZUSAMMENSETZUNG

EineFilmtabletteenthält1,6975mgPerindoprilentsprechend2,5mgPerindopril-Arginin,0,625mg

Indapamidund6,935mgAmlodipinbesilatentsprechend5mgAmlodipin.

[EineFilmtabletteenthält3.395mgPerindoprilentsprechend5mgPerindopril-Arginin,1,25mg

Indapamidund6,935mgAmlodipinbesilatentsprechend5mgAmlodipin.]

[EineFilmtabletteenthält3,395mgPerindoprilentsprechend5mgPerindopril-Arginin,1,25mg

Indapamidund13,870mgAmlodipinbesilatentsprechend10mgAmlodipin.]

VollständigeAuflistungdersonstigenBestandteilesieheAbschnitt6.1.

3. DARREICHUNGSFORM

Filmtablette.

Arplexam2,5/0,625/5mg:weiße,länglicheFilmtablette,8,5mmlangund4,5mmbreit,mitder

Prägung aufeinerSeiteundaufderanderenSeite.

Arplexam5/1,25/5mg:weiße,länglicheFilmtablette,9,75mmlangund5,16mmbreit,mitder

Prägung aufeinerSeiteundaufderanderenSeite.

Arplexam5/1,25/10mg:weiße,länglicheFilmtabletten,10,7mmlangund5,66mmbreit,mitder

Prägung aufeinerSeiteund aufderanderenSeite.

4. KLINISCHEANGABEN

4.1 Anwendungsgebiete

ArplexamwirdverwendetalsSubstitutionstherapiezurBehandlungderessentiellenHypertoniebei

Patienten,diebereitsmitPerindopril/IndapamidalsKombinationspräparatundAmlodipinin

denselbenStärkenbehandeltwurden.

4.2 DosierungundArtderAnwendung

Dosierung

EineFilmtabletteArplexamproTagalsEinzeldosis,vorzugsweisemorgensundvoreinerMahlzeit

einzunehmen.

DasKombinationspräparatistnichtzurInitialtherapiegeeignet.

WenneineÄnderungderDosierungerforderlichist,sollteeineTitrationmitdeneinzelnen

Komponentendurchgeführtwerden.

BesonderePatientengruppen

EingeschränkteNierenfunktion(sieheAbschnitt4.3und4.4)

BeischwererBeeinträchtigungderNierenfunktion(Kreatininclearanceunter30ml/min)istdie

Behandlungkontraindiziert.BeiPatientenmiteinermoderateneingeschränktenNierenfunktion

(Kreatininclearance30-60ml/min)sindArplexam-Dosenmit10mg/2,5mg/5mgund

10mg/2,5mg/10mgkontraindiziert.EsistempfohlendieBehandlungmiteinerangemessenenDosis

derfreienKombinationzubeginnen.

DieüblichemedizinischeKontrollewirdeinehäufigeBeobachtungvonKreatininundKalium

beinhalten.

DiegleichzeitigeAnwendungvonPerindoprilmitAliskirenistbeiPatientenmiteingeschränkter

Nierenfunktionkontraindiziert(GFR<60ml/min/1,73m2)(sieheAbschnitt4.3).

EingeschränkteLeberfunktion(sieheAbschnitte4.3,4.4und5.2)

BeischwererBeeinträchtigungderLeberfunktionistdieBehandlungkontraindiziert.

BeiPatientenmiteinerleichtenbismoderateneingeschränktenLeberfunktionsollteArplexammit

Vorsichtangewendetwerden,dakeineDosierungsempfehlungenfürAmlodipinbeidiesenPatienten

vorliegen.

ÄlterePatienten(sieheAbschnitt4.4)

DieAusscheidungvonPerindoprilatistbeiälterenPatientenverringert(sieheAbschnitt5.2).

ÄlterePatientenkönnenmitArplexamderNierenfunktionentsprechendbehandeltwerden(siehe

Abschnitt4.3).

KinderundJugendliche

DieSicherheitundWirksamkeitvonArplexambeiKindernundJugendlichenistnichterwiesen.Es

liegenkeineDatenvor.

ArtderAnwendung

ZumEinnehmen.

4.3 Gegenanzeigen

-Dialysepatienten

-Patientenmitunbehandelter,dekompensierterHerzinsuffizienz

-SchwereBeeinträchtigungderNierenfunktion(Kreatininclearanceunter30ml/min)

-ModerateBeeinträchtigungderNierenfunktion(Kreatininclearanceunter60ml/min)für

Arplexam-Dosen,die10mg/2,5mgderPerindopril/IndapamidKombinationenthalten(z.B.

Arplexam10mg/2,5mg/5mgund10mg/2,5mg/10mg)

-ÜberempfindlichkeitgegendieWirkstoffe,andereSulfonamide,andereDihydropyridinderivate,

andereACE-HemmerodereinenderinAbschnitt6.1genanntensonstigenBestandteile.

-Angioödem(Quincke-Ödem)inderAnamneseimZusammenhangmiteinervorausgegangenen

ACE-HemmerTherapie(sieheAbschnitt4.4)

-Hereditäres/idiopathischesAngioödem

-ZweitesunddrittesTrimesterderSchwangerschaft(sieheAbschnitte4.4und4.6)

-Stillzeit(sieheAbschnitt4.6)

-HepatischeEnzephalopathie

-SchwereBeeinträchtigungderLeberfunktion

-Hypokaliämie

-SchwereHypotonie

-Schock(einschließlichkardiogenerSchock)

-ObstruktiondeslinksventrikulärenAusflusstrakts(z.B.hochgradigeAortenstenose)

-HämodynamischinstabileHerzinsuffizienznacheinemakutenMyokardinfarkt

-GleichzeitigeAnwendungvonArplexammitAliskiren-haltigenArzneimittelnistbeiPatientenmit

DiabetesmellitusodereingeschränkterNierenfunktion(GFR<60mL/min/1,73m 2 )kontraindiziert

(sieheAbschnitte4.5und5.1).

4.4 BesondereWarnhinweiseundVorsichtsmaßnahmenfürdieAnwendung

AlleWarnhinweisedereinzelnenBestandteile,wieuntenaufgelistet,solltenauchfürdie

FixkombinationvonArplexamgelten.

BesondereWarnhinweise

Lithium

DieKombinationvonLithiummitderKombinationvonPerindopril/Indapamidistnormalerweise

nichtempfohlen(sieheAbschnitt4.5).

DualeBlockadedesRenin-Angiotensin-Aldosteron-Systems(RAAS)

EsgibtBelegedafür,dassdiegleichzeitigeAnwendungvonACE-Hemmern,Angiotensin-II-

Rezeptor-AntagonistenoderAliskirendasRisikofürHypotonie,HyperkaliämieundeineAbnahme

derNierenfunktion(einschließlicheinesakutenNierenversagens)erhöht.EinedualeBlockadedes

RAASdurchdiegleichzeitigeAnwendungvonACE-Hemmern,Angiotensin-II-Rezeptor-

AntagonistenoderAliskirenwirddeshalbnichtempfohlen(sieheAbschnitte4.5und5.1).

WenndieTherapiemiteinerdualenBlockadealsabsolutnotwendigerachtetwird,solltediesnur

unterAufsichteinesSpezialistenundunterDurchführungengmaschigerKontrollenvon

Nierenfunktion,ElektrolytwertenundBlutdruckerfolgen.

ACE-HemmerundAngiotensin-II-Rezeptor-AntagonistensolltenbeiPatientenmitdiabetischer

Nephropathienichtgleichzeitigangewendetwerden.

KaliumsparendeArzneimittel,KaliumergänzungsmitteloderkaliumhaltigeSalzersatzstoffe

EineKombinationvonPerindoprilmitkaliumsparendenArzneimitteln,Kaliumergänzungsmitteloder

kaliumhaltigenSalzersatzstoffenwirdnormalerweisenichtempfohlen(sieheAbschnitt4.5).

Neutropenie/Agranulozytose/Thrombozytopenie/Anämie

Neutropenie/Agranulozytose,ThrombozytopenieundAnämiewurdenbeiPatientenunterACE-

Hemmertherapieberichtet.BeiPatientenmitnormalerNierenfunktionundohneandere

KomplikationsfaktorenkommtesseltenzueinerNeutropenie.PerindoprilmussmitextremerVorsicht

angewendetwerdenbeiPatientenmitkollagenenGefäßerkrankungen,unterimmunsuppressiver

Therapie,währendderBehandlungmitAllopurinoloderProcainamidbeziehungsweiseeiner

KombinationdieserProblemfaktoren,insbesonderebeivorbestehendereingeschränkter

Nierenfunktion.EinigedieserPatientenentwickeltenschwereInfekte,dievereinzeltauchaufintensive

Antibiotikatherapienichtansprachen.WennPerindoprilbeisolchenPatientenangewendetwird,ist

eineregelmäßigeKontrolledesLeukozytenwertesangeratenunddiePatientenmüsseninstruiert

werden,jedesZeicheneinerInfektionzumelden(z.B.:wunderHals,Fieber)(sieheAbschnitt4.8).

Überempfindlichkeit/Angioödem

EinAngioödemdesGesichts,derGliedmaßen,Lippen,Zunge,Stimmritzeund/oderdesKehlkopfes

wurdeinseltenenFällenbeiPatienten,diemitACE-Hemmern,einschließlichPerindopril,behandelt

wurden,beobachtet.DieskannzujederZeitwährendderBehandlungauftreten.InsolchenFällen

mussPerindoprilsofortabgesetztwerdenundeinegeeigneteÜberwachungmussvorderEntlassung

desPatienteneingeleitetwerden,umdenvollständigenRückgangderSymptomesicherzustellen.In

FällenbeidenendieSchwellungaufGesichtundLippenbeschränktwar,verschwanddieseim

AllgemeinenohneBehandlung,obwohlAntihistaminehilfreichbeiderLinderungderSymptome

waren.

AngioödemeinVerbindungmitlaryngealenÖdemenkönnentödlichsein.WoeineBeteiligungder

Zunge,StimmritzeoderdesKehlkopfes,waswahrscheinlicheineAtemwegsobstruktionhervorrufen

kann,vorliegt,musssoforteinegeeigneteTherapiewelcheeinesubkutaneEpinephrinLösung1:1000

(0,3mlbis0,5ml)und/oderMaßnahmenfürdieSicherstellungfreierAtemwegebeinhaltenkönnte,

verabreichtwerden.

BeischwarzenPatienten,welcheACEHemmererhalten,wurdeeinehöhereInzidenzvon

Angioödemenbeobachtet,alsbeinicht-schwarzenPatienten.

PatientenmiteinemAngioödeminderAnamnese,welchesnichtinVerbindungzurACEHemmer

Therapiesteht,könneneinerhöhtesRisikofürAngioödemewährendderEinnahmevonACE

Hemmernaufweisen.(sieheAbschnitt4.3).

SeltenwurdenbeiPatienten,welchemitACEHemmernbehandeltwerden,intestinaleAngioödeme

beobachtet.BeidiesenPatiententratenabdominaleSchmerzenauf(mitoderohneÜbelkeitund

Erbrechen),inmanchenFällengabeskeinfrüheresGesichtsangioödemunddieC-1EsteraseSpiegel

warennormal.DasAngioödemwurdedurchMethodenwieAbdomen-CT,Ultraschalloderdurch

einenchirurgischenEingriffdiagnostiziert,wobeidieSymptomenachAbsetzendesACE–Hemmers

verschwanden.IntestinaleAngioödememüssenindieDifferenzialdiagnosebeiPatienten,diemit

ACE-HemmernbehandeltwerdenundbeidenenAbdominalschmerzenvorliegen,miteinbezogen

werden.

AnaphylaktischeReaktionenwährendderDesensibilisierung

EsgabeinzelneBerichteüberPatienten,welcheErfahrungenmitlängeranhaltenden,

lebensbedrohlichenanaphylaktischenReaktionenwährendACEHemmertherapiewährendder

DesensibilisierungsbehandlungmitHymenoptera-Gift(Bienen,Wespen)haben.ACEHemmer

müssenmitVorsichtbeiallergischenPatienten,welchemiteinerDesensibilisierungbehandelt

werden,angewendetundbeisolchen,diesicheinerImmuntherapiemitHymenopterengift

unterziehen,vermiedenwerden.DieseReaktionenkönnenjedochbeiPatienten,diesowohlACE-

HemmeralsauchDesensibilisierungstherapiebenötigen,vermiedenwerden,wennderACE-Hemmer

vorübergehendfürmindestens24StundenvorsolcheinerBehandlungabgesetztwird.

AnaphylaktischeReaktionenwährendderLDLApherese

Patienten,welcheACEHemmerwährendderLDLApheresemitDextranSulphatenerhielten,

erfuhrenseltenlebensbedrohlicheanaphylaktischeReaktionen.DieseReaktionenwurdendurch

vorübergehendesAbsetzenderACEHemmerTherapievorjederApheresevermieden.

HaemodialysePatienten

AnaphylaktischeReaktionenwurdenbeiPatientenbeobachtet,welcheeineDialysemitHigh-Flux

Membranen(z.B.:AN69

)erhieltenundwelchebegleitendmitACEHemmernbehandeltwurden.

BeidiesenPatientenmussderGebrauchandererTypenvonDialyseMembranenodereineranderen

ArteinesAntihypertensivumsinErwägunggezogenwerden.

Schwangerschaft

DieBehandlungmiteinemACE-HemmersolltenichtwährendeinerSchwangerschaftbegonnen

werden.SoferndieFortsetzungderBehandlungmiteinemACE-Hemmernichtalsunumgänglich

angesehenwird,solltevoreinergeplantenSchwangerschaftaufeinealternativeantihypertensive

Behandlungumgestelltwerden,dieeinetabliertesSicherheitsprofilfürdieAnwendunginder

Schwangerschaftbesitzt.SobaldeineSchwangerschaftfestgestelltwird,solltedieBehandlungmit

einemACE-Hemmersofortabgesetztund,fallserforderlich,miteinerAlternativbehandlungbegonnen

werden(sieheAbschnitte4.3und4.6).

HepatischeEnzephalopathie

WenndieLeberfunktionbeeinträchtigtist,könnenThiaziddiuretikaundthiazid-ähnlicheDiuretika

einehepatischeEnzephalopathieverursachen.WenndiesauftrittmussdieVerabreichungvon

Diuretikaunverzüglichabgebrochenwerden.

Photosensibilität

FällevonPhotosensibilitätsreaktionenmitThiazidenundthiazidähnlichenDiuretikawurdenberichtet

(sieheAbschnitt4.8).WenneinePhotosensibilitätsreaktionwährendderBehandlungauftritt,wird

empfohlendieBehandlungzustoppen.WenneineerneuteVerabreichungvondenDiuretika

unbedingtnotwendigist,wirdempfohlenfreiliegendeStellenvorSonneoderkünstlichemUVA-Licht

zuschützen.

VorsichtsmaßnahmenfürdieAnwendung

Nierenfunktion

-InFällenschwerereingeschränkterNierenfunktion(Kreatininclearance<30ml/min)istdie

Behandlungkontraindiziert.

-BeiPatientenmiteinermoderateneingeschränktenNierenfunktion(Kreatininclearance<60

ml/min)istdieBehandlungmitArplexam-Dosen,die10mg/2,5mgderPerindopril/Indapamid

Kombinationenthalten(z.B.Arplexam10mg/2,5mg/5mgund10mg/2,5mg/10mg),kontraindiziert.

-BeibestimmtenhypertonenPatientenohnevorhergehenderoffensichtlicherNierenschädigungund

beisolchenbeidenenBlutuntersuchungeneinefunktionelleNiereninsuffizienzgezeigthaben,

solltedieBehandlungabgesetztundentwedermitniedrigerDosisodernurmiteinemderbeiden

Bestandteilewiederaufgenommenwerden.

BeidiesenPatientenumfasstdieüblicheärztlicheKontrolleeineregelmäßigeKalium-und

Kreatininüberwachung,zunächst2WochennachTherapiebeginnunddannalle2Monatebei

unveränderterFortführungderTherapie.NierenversagenwurdevorallembeiPatientenmit

schwererHerzinsuffizienz,odereinerbestehendenNierenerkrankung,einschließlich

Nierenarterienstenose,beobachtet.

DieAnwendungdesArzneimittelswirdbeieinerbilateralenNierenarterienstenoseodernureiner

funktionierendenNierenormalerweisenichtempfohlen.

-RisikoeinerarteriellenHypotonieund/oderNiereninsuffizienz(inFällenvonHerzinsuffizienz,

Wasser-undElektrolytmangel,usw.):EineerheblicheStimulationdesRenin-Angiotensin-

Aldosteron-SystemswurdemitPerindoprilvorallemwährendstarkemWasser-und

Elektrolytmangel(strengekochsalzfreieDiätoderlängereDiuretikabehandlung)beiPatienten

beobachtet,derenBlutdruckinitialniedrigwar,inFällenvonNierenarterienstenose,kongestiver

HerzinsuffizienzoderZirrhosemitÖdemundAszites.

DieBlockierungdiesesSystemsdurcheinenACE-Hemmerkannhierbei,insbesonderebeider

erstenEinnahmeundwährenddererstenbeidenBehandlungswochen,einenplötzlichen

Blutdruckabfallund/odereinenAnstiegdesPlasmakreatininspiegelshervorrufen,deraufeine

funktionelleNiereninsuffizienzhinweist.Gelegentlichkanndiesakutauftreten,jedochseltenund

kannzuunterschiedlichenZeitpunktenauftreten.

IndiesenFällenmussdieBehandlungmiteinerniedrigerenDosisbegonnenundprogressiv

gesteigertwerden.BeiPatientenmitischämischerHerzkrankheitoderzerebrovaskulären

ErkrankungenkönnteeinstarkerBlutdruckabfallzueinemMyokardinfarktbzw.einem

zerebrovaskulärenEreignisführen.

-ThiaziddiuretikaundthiazidähnlicheDiuretikasindnurdannvollwirksam,wenndie

Nierenfunktionnormalodernurwenigbeeinträchtigtist(Kreatininspiegelniedrigeralsca.25mg/l,

d.h.220Micromol/lfüreinenErwachsenen).

BeiälterenPatientensollderWertderPlasma-KreatininspiegelinAbhängigkeitvonAlter,

GewichtundGeschlechtangepasstwerden.

DieHypovolämiealsFolgevonWasser-undNatriumverlustdurchdasDiuretikumzuBeginnder

BehandlungbewirkteineReduktionderglomerulärenFiltration.DarauskanneinAnstiegdes

BlutharnstoffsunddesKreatininspiegelsentstehen.Diesevorübergehendefunktionelle

NiereninsuffizienzhatbeiPatientenmitnormalerNierenfunktionkeinenachteiligen

Konsequenzen,kannjedochwieauchimmereinebereitsbestehendeeingeschränkte

Nierenfunktionverschlechtern.

-AmlodipinkannbeiPatientenmitNierenversageninnormalenDosierungenverabreichtwerden.

VeränderungenderAmlodipinplasmaspiegelkorrelierennichtmitdemGradder

Nierenfunktionseinschränkung.

-DerEffektderKombinationArplexamwurdenichtbeiNierenfunktionsstörunggetestet.Beieiner

NierenfunktionsstörungsolltenfürdieArplexam-DosenjenedereinzelnenKomponentenseparat

beachtetwerden.

HypotonieundWasserundNatriummangel:

-LiegteinNatriummangelvor,bestehtdasRisikoeinerplötzlichenHypotonie(insbesonderebei

PatientenmitNierenarterienstenose).DeshalbsollteeinesystematischeUntersuchungaufklinische

AnzeicheneinesWasserundElektrolytmangelsdurchgeführtwerden,welchermöglicherweisemit

EpisodenvonDurchfalloderErbrechenauftritt.EineregelmäßigeKontrollederPlasmaelektrolyte

mussbeisolchenPatientenerfolgen.

EineausgeprägteHypotoniekanneineintravenöseInfusionmitisotonischerKochsalzlösung

erforderlichmachen.

EinevorübergehendeHypotonieistkeineGegenanzeigefürdieFortsetzungderBehandlung.Nach

derWiederherstellungeineszufriedenstellendenBlutvolumensundBlutdruckskanndie

BehandlungentwedermitreduzierterDosierungodermitnureinemderBestandteilewieder

aufgenommenwerden.

-JedeDiuretikatherapiekanneinAbsinkendesNatriumspiegelshervorrufen,wasmöglicherweise

schwerwiegendeFolgenhabenkann.EinAbsinkenderNatriumspiegelkannanfänglich

asymptomatischseinunddaheristeineregelmäßigeÜberprüfungunbedingtnotwendig.Die

ÜberprüfungmussbeiälterenundZirrhosepatientenhäufigererfolgen.(sieheAbschnitte4.8und

4.9).

Kaliumspiegel

-DieKombinationvonIndapamidmitPerindoprilundAmlodipinverhindertnichtdasAuftreten

einerHypokaliämie,insbesonderebeiDiabetikernoderPatientenmitNierenversagen.Wiebei

allenanderenantihypertensivenArzneimitteln,welcheeinDiuretikumbeinhalten,musseine

regelmäßigeÜberwachungdesPlasmakaliumspiegelserfolgen.

-ErhöhungendesSerumkaliumswurdenbeimanchenPatienten,diemitACE-Hemmerinklusive

Perindoprilbehandeltwurden,beobachtet.RisikofaktorenfürdieEntwicklungeinerHyperkaliämie

schließenNiereninsuffizienz,VerschlechterungderNierenfunktion,Alter(>70Jahre),Diabetes

mellitus,interkurrenteEreignisse,insbesondersDehydration,akuteHerzdekompensation,

metabolischeAzidoseundgleichzeitigerGebrauchvonkaliumsparendenDiuretika(z.B.

Spironolakton,Eplerenon,TriamterenoderAmilorid),Kaliumsupplementeoderkaliumhaltige

Salzersatzstoffe,odersolchePatienten,welcheandereArzneimitteldieeineErhöhungdes

Serumkaliums(z.B.:Heparin)hervorrufen,mitein.DerGebrauchvonKaliumsupplementen,

kaliumsparendenDiuretikaoderkaliumhaltigenSalzersatzstoffen,besondersbeiPatientenmit

beeinträchtigterNierenfunktion,kannzueinemsignifikantenAnstiegdesSerumkaliumsführen.

Hyperkaliämiekannschwerwiegende,manchmaltödlicheArrhythmienverursachen.Wennder

gleichzeitigeGebrauchderobengenanntenArzneimittelunbedingtnotwendigist,müssendiesemit

VorsichtundunterständigerBeobachtungdesSerumkaliumsangewendetwerden.(sieheAbschnitt

4.5).

-DerKaliummangelmitHypokaliämieistdasHauptrisikobeiThiaziddiuretikaundthiazidähnlichen

Diuretika.DasRisikodesAuftretensniedrigerKaliumspiegel(<3,4mmol/l)mussbeibestimmten

Hochrisikopopulationenwieälterenund/oderunterernährtenPatientenmitoderohnemehrfacher

Medikation,ZirrhosepatientenmitÖdemenundAszites,PatientenmitkoronarerHerzerkrankung

undPatientenmitHerzinsuffizienzvermiedenwerden.

InsolchenFällenerhöhtdieHypokaliämiedieKardiotoxizitätderHerzglykosideunddasRisiko

vonRhythmusstörungen.

PatientenmiteinemlangenQT-Intervall,sowohlkongenitalenalsauchiatrogenenUrsprungs,

gehörenebenfallszurRisikogruppe.DieHypokaliämiesowieauchdieBradykardieagierenals

FaktorenwelchedasAuftretenschwererHerzrhythmusstörungen,insbesondereTorsades-de-

pointeswelchetödlichseinkönnen,begünstigen.

InallenFällensindhäufigereUntersuchungendesKaliumspiegelserforderlich.DieersteMessung

desPlasmakaliumspiegelsmusswährenddererstenWochenachBeginnderBehandlung

stattfinden.

SolltenniedrigeKaliumspiegelfestgestelltwerden,isteineKorrekturerforderlich.

Calciumspiegel

ThiaziddiuretikaundthiazidähnlicheDiuretikakönnendieCalciumausscheidungimHarnvermindern

undzueinemgeringenundvorübergehendenAnstiegdesPlasmaCalciumspiegelsführen.Stark

erhöhteCalciumspiegelkönneninVerbindungmiteinemundiagnostiziertenHyperparathyreoidismus

stehen.InsolchenFällenmussdieBehandlungabgebrochenwerdenbevordieNebenschilddrüsen-

Funktionuntersuchtwird(sieheAbschnitt4.8).

RenovaskuläreHypertonie

RevaskularisationistdieBehandlungsmethodebeirenovaskulärerHypertonie.DennochkönnenACE-

HemmerfürPatientenmitrenovaskulärerHypertoniegünstigsein,dieaufeinenchirurgischen

EingriffwartenoderwenneinsolcherEingriffnichtmöglichist.

WennArplexamPatientenmitbekannterodervermuteterNierenarterienstenoseverschriebenwird,

solltedieBehandlungimKrankenhausmitniedrigerDosisundunterÜberwachungder

NierenfunktionunddesKaliumspiegelsbegonnenwerden,damanchePatienteneinefunktionelle

Niereninsuffizienzentwickelthaben,diebeiBehandlungsabbruchreversibelwar.

Husten

BeiderAnwendungvonACE-HemmernwurdevontrockenemHustenberichtet.Persistenzsowie

AbklingennachBeendigungderBehandlungistfürihncharakteristisch.EineiatrogeneÄthiologie

sollteimFallediesesSymptomsinBetrachtgezogenwerden.WenndieVerschreibungeinesACE-

Hemmersweiterhinbevorzugtwird,kanndieFortsetzungderBehandlunginErwägunggezogen

werden.

Atherosklerose

DasRisikoderHypotoniebestehtbeiallenPatienten,jedochsolltebesondereVorsichtbeiPatienten

mitischämischenHerzerkrankungenoderzerebralerDurchblutungsstörunggebotensein,indemdie

BehandlungmiteinerniedrigenDosisbegonnenwird.

HypertensiveKrise

DieSicherheitundWirksamkeitvonAmlodipinineinerhypertensivenKrisekonntennichtbestätigt

werden.

Herzversagen/schwereHerzinsuffizienz

PatientenmitHerzinsuffizienzsolltenmitVorsichtbehandeltwerden.

IneinerplacebokontrolliertenLangzeitstudieanPatientenmitschwererHerzinsuffizienz(NYHAIII

undIV)wardieInzidenzfürLungenödemeinderAmlodipingruppehöheralsinderPlacebogruppe.

Calciumkanalblocker,einschließlichAmlodipin,solltenbeiPatientenmitkongestiverHerzinsuffizienz

mitVorsichtangewendetwerden,dasiedasRisikozukünftigerkardiovaskulärerEreignisseunddas

Mortalitätsrisikoerhöhenkönnen.

BeiPatientenmitschwererHerzinsuffizienz(StadiumIV)mussdieBehandlunguntermedizinischer

ÜberwachungmitreduzierterAnfangsdosisbegonnenwerden.BeihypertensivenPatientenmit

KoronarinsuffizienzsolltedieBehandlungmitBetablockernnichtunterbrochenwerden:derACE-

HemmersolltedemBetablockerhinzugefügtwerden.

Aorta-oderMitralklappenstenose/hypertropheKardiomyopathie

ACE-HemmermüssenbeiPatientenmiteinerLinksventrikelstenosevorsichtigangewendetwerden.

Diabetiker

BeiPatientenmitinsulinabhängigemDiabetesmellitus(spontaneTendenzzuerhöhten

Kaliumspiegeln)mussdieBehandlunguntermedizinischerÜberwachungmitreduzierter

Anfangsdosisbegonnenwerden.

DieBlutzuckerspiegelmüssenbeiDiabetikern,welchevorhergehendmitoralenantidiabetischen

MedikamentenoderInsulinbehandeltwurden,strengüberwachtwerden,hauptsächlichwährenddes

erstenMonatsderBehandlungmitACE-Hemmern.

EineÜberwachungdesBlutzuckersbeiDiabetikernistwichtig,vorallemwenndieKaliumspiegel

niedrigsind.

EthnischeUnterschiede

WiemitanderenACE-HemmernistPerindopriloffensichtlichwenigerantihypertensivwirksambei

schwarzenPatientenalsbeinicht-schwarzenPatienten,möglicherweiseaufgrundeinerhöheren

PrävalenzniedrigerReninSpiegelderschwarzenhypertensivenPopulation.

ChirurgischerEingriff/Anästhesie

ACE-HemmerkönnenHypotonieimFalleeinerAnästesiehervorrufen,insbesonderswenndas

verabreichteAnästhetikumeinArzneimittelmithypotensivemPotenzialist.

Daherwirdempfohlen,dieBehandlungmitlangwirksamenACE-HemmernwiePerindopril

abzusetzen,wennmöglicheinenTagvordemchirurgischenEingriff.

Leberinsuffizienz

SeltenwurdenACE-HemmermiteinemSyndrominZusammenhanggebracht,dasmitcholestatischer

Gelbsuchtbeginnt,sichinfulminanterhepatischerNekrosefortsetztund(manchmal)zumTodführt.

DerMechanismusdiesesSyndromsistnichtbekannt.Patienten,dieunterACE-Hemmertherapieeine

GelbsuchtentwickelnodererhöhteLeberenzymwertezeigen,müssendenACE-Hemmerabsetzenund

eineentsprechendemedizinischeNachbehandlungerhalten(sieheAbschitt4.8).

DieHalbwertszeitvonAmlodipinistbeiPatientenmiteingeschränkterLeberfunktionverlängertund

dieAUC-Wertesindhöher;Dosierungsempfehlungenliegenjedochnichtvor.Amlodipinsolltedaher

amunterenEndedesDosierungsbereichsbegonnenwerdenundsowohlbeiTherapiebeginnalsauch

beieinerDosiserhöhungmitVorsichtverabreichtwerden.BeiPatientenmitschwerer

LeberfunktionsstörungkanneinelangsameDosistitrationundengmaschigeÜberwachungnotwendig

sein.

DerEffektderKombinationArplexamwurdenichtbeiLeberfunktionsstörunggetestet.Unter

BerücksichtigungdesEffektsjedereinzelnenKomponentedieserKombination,istArplexambei

PatientenmitschwerenLeberfunktionsstörungenkontraindiziert,undVorsichtistgebotenbei

PatientenmiteinerleichtenbismoderateneingeschränktenLeberfunktion.

Harnsäure

DieTendenzzuGichtanfällenkannbeihyperurikämischenPatientenerhöhtsein.

ÄlterePatienten

DieNierenfunktionundderKaliumspiegelmüssenvorBehandlungsbeginnüberprüftwerden.Dieam

AnfangverabreichteDosiswirdspäterentsprechenddenBlutdruckwertenangepasst,insbesonderebei

FällenvonWasser-undElektrolytmangel,umdasplötzlicheAuftreteneinerHypotoniezuvermeiden.

BeiälterenPatientensollteeineDosiserhöhungvonAmlodipinmitVorsichterfolgen(siehe

Abschnitte4.2und5.2).

4.5 WechselwirkungenmitanderenArzneimittelnundsonstigeWechselwirkungen

DatenausklinischenStudienhabengezeigt,dasseinedualeBlockadedesRenin-Angiotensin-

Aldosteron-Systems(RAAS)durchgleichzeitigeAnwendungvonACE-Hemmern,Angiotensin-II-

Rezeptor-AntagonistenoderAliskirenimVergleichzurAnwendungeinereinzelnenSubstanz,dieauf

dasRAASwirkt,miteinerhöherenRateanunerwünschtenEreignissenwieHypotonie,

HyperkaliämieundeinerAbnahmederNierenfunktion(einschließlicheinesakutenNierenversagens)

einhergeht(sieheAbschnitte4.3,4.4und5.1).

Arzneimittel,dieeineHyperkaliämieinduzieren:

EinigeArzneimittelbzw.therapeutischeKlassenkönnendasRisikofürdasAuftreteneiner

Hyperkaliämieerhöhen:Aliskiren,Kaliumsalze,kaliumsparendeDiuretika,ACE-Hemmer,

Angiotensin-II-RezeptorAntagonisten,NSAR,Heparine,ImmunsuppressivawieCiclosporinoder

Tacrolismus,Trimethoprim.DiegleichzeitigeAnwendungdieserArzneimittelerhöhtdasRisikofür

eineHyperkaliämie.

GleichzeitigerGebrauchistkontraindiziert(sieheAbschnitt4.3):

Aliskiren:beiPatientenmitDiabetesodereingeschränkterNierenfunktionistdasRisikofürdas

AuftreteneinerHyperkaliämieundfüreineVerschlechterungderNierenfunktionunddie

kardiovaskuläreMorbiditätundMortalitäterhöht.

GleichzeitigerGebrauchwirdabgeraten:

Substanz BekannteWechselwirkung

mitfolgendemProdukt WechselwirkungmitanderenArzneimitteln

Perindopril/ Lithium ReversibleErhöhungenvonSerumLithiumkonzentrationenund

Indapamid ToxizitätwurdenbeigleichzeitigerEinnahmevonLithiumund

ACE-Hemmernbeobachtet.DerGebrauchvonPerindopril

kombiniertmitIndapamidmitLithiumwirdnichtempfohlen,falls

aberdieKombinationalsnotwendigerscheint,mussderSerum

Lithiumspiegelsorgfältigüberwachtwerden.(sieheAbschnitt4.4).

Perindopril Aliskiren BeiallenPatienten,außerDiabetikernoderPatientenmit

eingeschränkterNierenfunktion,istdasRisikofürdasAuftreten

einerHyperkaliämie,füreineVerschlechterungderNierenfunktion

unddiekardiovaskuläreMorbiditätundMortalitäterhöht(siehe

Abschnitt4.4).

GleichzeitigeAnwendung

vonACE-Hemmernund

Angiotensin-Rezeptor-

Blockern InderLiteraturwurdedavonberichtet,dassbeiPatientenmit

bekannterArteriosklerose,HerzinsuffizienzoderDiabetesmit

EndorganschädigungdiegleichzeitigeBehandlungmitACE-

HemmernundAngiotensin-Rezeptor-Blockernmiteinererhöhten

HäufigkeitanHypotonie,Synkope,Hyperkaliämieundeiner

VerschlechterungderNierenfunktion(einschließlichakutes

Nierenversagen)verbundenist,imVergleichzuralleinigen

AnwendungeinesInhibitorsdesRAAS.EinedualeBlockade(z.B.

durchKombinationeinesACE-HemmersmiteinemAngiotensin-

II-Antagonisten)sollteaufbestimmteEinzelfällemitengmaschiger

ÜberwachungderNierenfunktion,desKalium-Spiegelsunddes

Blutdrucksbeschränktwarden(sieheAbschnitt4.4).

Estramustin EsbestehteinerhöhtesRisikofürdasAuftretenunerwünschter

Wirkungenwiez.B.einesAngioödems.

KaliumsparendeDiuretika

(z.B.Triameteren,

Amilorid),Kalium(salze) Hyperkaliämie(potentielllebensbedrohlich),vorallembei

eingeschränkterNierenfunktion(additivehyperkaliämische

Wirkung).VoneinerKombinationvonPerindoprilmitdenoben

genanntenArzneimittelnwirdabgeraten(sieheAbschnitt4.4.).

WenndennocheineBegleittherapieangezeigtist,solltesiemit

VorsichtundhäufigenMessungenderKaliumspiegelangewendet

werden.ZurAnwendungvonSpironolactonbeiHerzinsuffizienz,

siehe“GleichzeitigerGebrauchwelcherVorsichtsmaßnahmen

erfordert“.

Amlodipin Dantrolen(Infusion) ImTiermodellwurdenachVerabreichungvonVerapamilund

intravenösem Dantrolen letales Kammerflimmern und

KreislaufkollapsinVerbindungmitHyperkaliämiebeobachtet.

AufgrunddesHyperkaliämierisikoswirdempfohlen,eine

gleichzeitigeGabevonCalciumkanalblockernwieAmlodipinbei

denPatientenzuvermeiden,dieempfänglichfüreinemaligne

HyperthermiesindoderwegeneinermalignenHyperthermie

behandeltwerden.

Grapefruitoder

Grapefruitsaft DieBioverfügbarkeitkannbeieinigenPatientenerhöhtsein,was

zueinerverstärktenBlutdrucksenkungführenwürde.

GleichzeitigerGebrauchwelcherVorsichtsmaßnahmenerfordert:

Komponente Bekannte

Wechselwirkungmit

folgendemProdukt WechselwirkungmitanderenArzneimitteln

Baclofen VerstärkungderantihypertensivenWirkung.Überwachungdes

BlutdrucksundDosisanpassungdesAntihypertensivumswennnötig. Perindopril/

Indapamid

Nichtsteroidale

entzündungshem-mende

Arzneimittel(hochdosierte

Acetylsalizylsäure

inkludiert) Wenn ACE-Hemmer gleichzeitig mit nicht steriodalen

entzündungshemmendenMedikamentenverabreichtwerden(z.B.

AcetylsalicylsäureinentzündungshemmendergeregelterDosis,

COX-2Hemmerundnicht-selektiveNSARs)kanneine

AbschwächungdesantihypertonenEffektesauftreten.Der

gleichzeitigeGebrauchvonACE-HemmernundNSARskannzu

einemerhöhtemRisikoderVerschlechterungderNierenfunktionen,

welchesauchmiteinerakutenNiereninsuffizienzundeinemAnstieg

desKaliumspiegelseinhergehendseinkann,vorallemPatientenmit

vorhergehenden Nierenfunktionsstörungen, führen. Diese

KombinationsolltevorallembeiälterenPatientenmitVorsicht

verabreichtwerden.Patientensolltenadäquathydriertwerdenund

Komponente Bekannte

Wechselwirkungmit

folgendemProdukt WechselwirkungmitanderenArzneimitteln

eineÜberwachungderNierenfunktionennachBeginnder

BegleitmedikationundinweitererFolgeregelmäßiginErwägung

gezogenwerden.

Antidiabetika(Insulin,

oralehypoglykämische

Arzneimittel) EpidemiologischeStudienlassenvermuten,dassdiegleichzeitige

BehandlungmitACE-HemmernundAntidiabetika(Insulin,orale

hypoglykämischeArzneimittel)einegesteigerteBlutzuckersenkung

mitRisikoeinerHypoglykämieverursachenkann.DiesesPhänomen

scheintwährenddenerstenWocheneinerKombinationstherapieund

beiPatientenmitNierenfunktionsstörungeheraufzutreten.

Nicht-kaliumsparende

Diuretika BeiPatientenuntereinerDiuretikatherapie,insbesonderebeisolchen

mitPlasmavolumenverlustund/oderSalzmangel,kannnach

TherapiebeginnmiteinemACE-Hemmereineübermäßige

Blutdrucksenkungauftreten.MöglichehypotensiveEffektekönnen

reduziertwerdendurchAbsetzendesDiuretikums,durch

VolumenerhöhungoderSalzeinnahmevorTherapiebeginnmit

PerindoprilinniedrigenDosierungen,dielangsamgesteigertwerden.

Wenn bei arterieller Hypertonie eine vorangegangene

DiuretikatherapiezuSalz-/Volumenverlustgeführthat,sollte

entwederdasDiuretikumvorBeginnderACE-Hemmer-Behandlung

abgesetztwerdenunddannggf.zusätzlicheinnicht-kaliumsparendes

Diuretikumangewendetwerden,oderdieACE-HemmerTherapie

mitniedrigerDosisbegonnenunddannallmählichgesteigertwerden.

BeiherzinsuffizientenPatienten,diemitDiuretikabehandeltwerden,

solltedieBehandlungmiteinemACE-Hemmermitsehrniedriger

Dosisbegonnenwerden.WennmöglichsolltevorherdieDosisdes

nicht-kaliumsparendenDiuretikumsreduziertwerden.

InjedemFallsolltedieNierenfunktion(Serum-Kreatinin)inden

Perindopril

KaliumsparendeDiuretika

(Eplerenon,Spironolacton) KombinationvonEplerenonoderSpironolactonbeieinerDosierung

von12,5mgbis50mgtäglichundniedrigdosiertenACE-Hemmern:

BeiderBehandlungeinerHerzinsuffizienzNYHA-KlasseII-IVmit

einerEjektions-Fraktionvon<40%undvorangegangenerTherapie

mitACE-HemmernundSchleifendiuretikabestehtdasRisikofür

eine lebensbedrohliche Hyperkaliämie, insbesondere bei

Nichtbeachten der Verschreibungsempfehlungen für diese

Kombination.

VorTherapiebeginnmitdieserKombinationsollender

KaliumspiegelaufAbwesenheiteinerHyperkaliämieunddie

Nierenfunktionüberprüftwerden.

EineengmaschigeÜberwachungderSerumkaliumwerteund

KreatininwertewirdimerstenBehandlungsmonateinmal

wöchentlichempfohlen,danachmonatlich.

Indapamid Torsades-de-pointes

induzierendeArzneimittel AufgrunddesRisikoseinerHypokaliämiesollteIndapamidmit

Vorsichtverabreichtwarden,wennesinVerbindungmit

ArzneimittelnstehtwelcheTorsades-de-pointeshervorgerufenhaben,

wie:

-KlasseIAAntiarrhythmika(Quinidin,Hydroquinidin,

Disopyramid);

-KlasseIIIAntiarrhythmika(Amiodaron,Dofetilid,Ibutilid,

Bretylium,Sotalol);

-einigeNeuroleptika(Chlorpromazin,Cyamemazin,

Levomepromazin,Thioridazin,Trifluoperazin),Benzamide

(Amisulprid,Sulpirid,Sultoprid,Tiaprid),Butyrophenone

(Droperidol,Haloperidol),andereNeuroleptika(Pimozid);

-andereWirkstoffewieBepridil,Cisaprid,Diphemanil,i.v.

Erythromycin,Halofantrin,Mizolastin,Moxifloxacin,Pentamidin,

Sparfloxacin,i.v.Vincamin,Methadon,Astemizol,Terfenadin.

VorbeugungvonniedrigenKaliumspiegelnundKorrekturfalls

notwendig:BeobachtungdesQTIntervalls.

AmphotericinB(i.v.), ErhöhtesRisikoniedrigerKaliumspiegel(additiveWirkung).

Komponente Bekannte

Wechselwirkungmit

folgendemProdukt WechselwirkungmitanderenArzneimitteln

Gluco-und

Mineralocorticoide

(systemisch),

Tetracosactid,

stimulierendeLaxantien ÜberwachungundwennnötigKorrekturdesKaliumspiegels;

besonderszubeachteninFällenderBehandlungmitHerzglykoside.

NichtstimulierendeLaxantiensolltenverwendetwerden.

HerzwirksameGlykoside NiedrigeKaliumspiegelbegünstigendietoxischenWirkungender

herzwirksamenGlykoside.KaliumspiegelundEKGmüssen

überwachtundwennnötigdieBehandlungüberdachtwerden.

Allopurinol DiegleichzeitigeBehandlungmitIndapamidkannzueinem

häufigerenAuftretenvonHypersensibilitätsreaktionendurch

Allopurinolführen

Amlodipin CYP3A4-Induktoren EsliegenkeineDatenüberdieWirkungvonCYP3A4-Induktorenauf

Amlodipinvor.DiegleichzeitigeAnwendungvonCYP3A4-

Induktoren(z.B.Rifampicin,Johanniskraut)könntezureduzierten

Amlodipin-Plasmakonzentrationenführen.Diegleichzeitige

AnwendungvonAmlodipinundCYP3A4-Induktorensollmit

Vorsichterfolgen.

CYP3A4-Inhibitoren DiegleichzeitigeAnwendungvonAmlodipinmitstarkenoder

mäßigenCYP3A4-Inhibitoren(Proteaseinhibitoren,Azol-

Antimykotika,MakrolidewieErythromycinoderClarithromycin,

VerapamiloderDiltiazem)kannzueinersignifikantenErhöhungder

Amlodipin-Expositionführen.DieklinischenKonsequenzender

geändertenPharmakokinetikkönnenbeiälterenPatienten

ausgeprägtersein.DaherkönneneineklinischeKontrolleundeine

Dosisanpassungnotwendigwerden.

GleichzeitigerGebrauchwelcherberücksichtigtwerdensoll:

Komponente Bekannte

Wechselwirkung

mitfolgendem

Produkt WechselwirkungmitanderenArzneimitteln

Perindopril/

Indapamid/

Amlodipin Antidepressivavom

Imipramin Typ

(trizyklische),

Neuroleptika VerstärkteantihypertensiveWirkungunderhöhtesRisikoeiner

orthostatischenHypotonie(additiveWirkung).

Andere

Antihypertonika DieAnwendungvonanderenantihypertensivenArzneimittelnkönntezu

einerweiterenblutdrucksenkendenWirkungführen.

Kortikoide,

Tetracosactid VerminderungderantihypertensivenWirkung(Salz-undWasserretention

durchdieKortikoide).

Antihypertensiva

undVasodilatoren DiegleichzeitigeAnwendungvonNitroglycerinundanderenNitratenoder

anderenVasodilatorenkannzueinemweiterenAbsinkendesBlutdrucks

führen. Perindopril

Allopurinol,

zytostatischeoder

immunsuppressive

Arzneimittel,

systemische

Kortikosteroide

oderProcainamid DiegleichzeitigeVerabreichungvonACE-Hemmernkannzueinem

erhöhtenRisikofürLeukopenieführen.

Anästhetika ACE-HemmerkönnendiehypotensiveWirkungvonbestimmten

Anästhetikaerhöhen.

Diuretika(Thiazid

oder

Schleifendiuretika) VortherapiemithochdosiertenDiuretikakönnenzueinem

VolumenmangelführenundzueinemRisikoeinerHypotoniebei

TherapiebeginnmitPerindopril.

Gliptine

(Linagliptin,

Saxagliptin, BeiPatienten,diegleichzeitigeinenACE-Hemmererhalten,besteht

aufgrund der durch das Gliptin reduzierten Aktivität der

Dipeptidylpeptidase4(DPP4),einerhöhtesRisikofürdasAuftreteneines

Komponente Bekannte

Wechselwirkung

mitfolgendem

Produkt WechselwirkungmitanderenArzneimitteln

Sitagliptin,

Vildagliptin) Angioödems.

Sympathomimetika SympathomimetikakönnendenantihypertensivenEffektderACE-

Hemmerabschwächen.

Gold NitritoideReaktionen(SymptomebeinhaltenFlush,Übelkeit,Erbrechen

undHypotonie)wurdenseltenbeiPatientenunterTherapiemit

injizierbaremGold(NatriumAurothiomalat)undgleichzeitigerACE-

HemmerTherapiewelchePerindoprilbeinhaltet,beobachtet.

Indapamid Metformin Metformin-bedingteLaktatazidose,ausgelöstdurcheinemögliche

funktionelleNiereninsuffizienzimZusammenhangmitDiuretika,

insbesonderebeiSchleifendiuretika.VerwendenSiekeinMetforminwenn

diePlasmakreatininspiegel15mg/l(135Micromol/l)beiMännernund12

mg/l(110Micromol/l)beiFrauenübersteigen.

Iodhaltige

Kontrastmittel InFällenvonDehydrationausgelöstdurchDiuretikabestehtinsbesondere

beiAnwendunghoherDoseniodhaltigerKontrastmitteleinerhöhtes

RisikoeinerakutenNiereninsuffizienz.EineRehydrierungmussvorder

VerabreichungderiodhaltigenSubstanzdurchgeführtwerden.

Calcium(salze) Risiko eines erhöhten Calciumspiegels durch verminderte

CalciumausscheidungimHarn.

Ciclosporin RisikoeineserhöhtenKreatininspiegelsohneÄnderungderzirkulierenden

Ciclosporinkonzentration,auchbeinichtvorhandenenSalzund

Wassermangel.

Atorvastatin,

Digoxin,Warfarin

orCiclosporin InklinischenWechselwirkungsstudienzeigteAmlodipinkeinenEinfluss

aufdiePharmakokinetikvonAtorvastatin,Digoxin,Warfarinoder

Ciclosporin. Amlodipin

Simvastatin DiegleichzeitigeMehrfachgabevon10mgAmlodipinmit80mg

Simvastatinführte,imVergleichzuralleinigenGabevonSimvastatin,zu

einer77%igenErhöhungderSimvastatin-Exposition.BeiPatienten,die

Amlodipinerhalten,istdieDosisvonSimvastatinauf20mgtäglichzu

beschränken.

4.6 Fertilität,SchwangerschaftundStillzeit

ZiehtmandieEinzelkomponentendiesesKombinationsprodukteshinsichtlichSchwangerschaftund

StillzeitinBetracht,wirdArplexamwährenddem1.Schwangerschaftstrimesternichtempfohlen.

WährenddeszweitenunddrittenSchwangerschaftstrimestersistArplexam kontraindiziert.

ArplexamistwährendderStillzeitkontraindiziert.Essolltedaherentschiedenwerden,obder

AbbruchderEinnahmevonArplexamoderderAbbruchdesStillenshinsichtlichderWichtigkeitder

TherapiefürdieMuttervorzuziehenist.

Schwangerschaft

Perindopril

DieAnwendungvonACE-HemmerwirdimerstenSchwangerschaftstrimesternichtempfohlen

(sieheAbschnitt4.4).DieAnwendungvonACE-Hemmeristwährenddeszweitenunddritten

Schwangerschaftstrimesterskontraindiziert(sieheAbschnitte4.3und4.4).

DieepidemiologischeEvidenzbezüglichdesTeratogenitätsrisikosnacheinerBehandlungmiteinem

ACE-HemmerimerstenSchwangerschaftstrimesteristnichtschlüssig,jedochkanneinleicht

erhöhtesRisikonichtausgeschlossenwerden.SoferndieFortsetzungderBehandlungmiteinemACE

-Hemmernichtalsunumgänglichangesehenwird,solltevoreinergeplantenSchwangerschaftauf

einealternativeantihypertensiveBehandlungumgestelltwerden,dieeinetabliertesSicherheitsprofil

fürdieAnwendunginderSchwangerschaftbesitzt.SobaldeineSchwangerschaftfestgestelltwird,

solltedieBehandlungmiteinemACE-Hemmersofortabgesetztundfallserforderlichmiteiner

Alternativbehandlungbegonnenwerden.

Esistbekannt,dassdieTherapiemiteinemACE-Hemmerwährenddeszweitenunddritten

Trimestersfoetotoxischwirkt(Nierenfunktionsstörung,Oligohydramnion,Verlangsamungder

Schädel-Ossifikation)undbeimNeugeborenentoxischeWirkungen(Nierenversagen,Hypotonie,

Hyperkaliämie)auslösenkann(sieheAbschnitt5.3).

SollteeineExpositionmiteinemACE-Hemmerabdem2.Schwangerschaftstrimestersstattgefunden

haben,werdenUltraschallkontrollenderNierenfunktionunddesSchädelsempfohlen.

Säuglinge,derenMütterACE-Hemmereingenommenhaben,müssenengmaschigimHinblickauf

Hypotonieüberwachtwerden(sieheAbschnitte4.3und4.4).

Indapamid:

EsliegenkeineodernurbegrenzteErfahrungen(wenigerals300Schwangerschaftsausgänge)mitder

AnwendungvonIndapamidbeiSchwangerenvor.

EinelängereExpositiongegenüberThiazidenwährenddesdrittenSchwangerschaftstrimesterskann

dasmütterlichePlasmavolumenreduzieren,sowiedenuteroplazentarenBlutfluss,waseineFeto-

PlazentaIschämieundeineWachstumsverzögerungverursachenkann.Außerdemwurdenvereinzelt

FällevonHypoglykämieundThrombocytopeniebeiNeugeboreneninFolgeeinergeburtsnahen

Expositionberichtet.

TierexperimentelleStudienergabenkeineHinweiseaufdirekteoderindirektegesundheitsschädliche

WirkungeninBezugaufeineReproduktionstoxizität(sieheAbschnitt5.3).

Amlodipin:

DieSicherheitvonAmlodipininderSchwangerschaftfürMenschenistnichterwiesen.

IntierexperimentellenStudienwurdebeihohenDoseneineReproduktionstoxizitätbeobachtet(siehe

Abschnitt5.3).

Stillzeit

ArplexamistwährendderStillzeitkontraindiziert.

Perindopril

DakeinerleiInformationüberdieAnwendungvonPerindoprilwährendderStillzeitvorhandenist,

wirddieAnwendungvonPerindoprilnichtempfohlenundessollteeinealternativeBehandlung

vorgezogenwerde,dieeinbesseretabliertesSicherheitsprofilwährendderStillzeitbesitzt,

insbesonderewährendderStillzeitvonNeugeborenenundFrühgeborenen.

Indapamid

EsgibtnurungenügendeInformationendarüber,obIndapamid/MetaboliteindieMuttermilch

übergehen.EinRisikofürdasNeugeborene/Kindkannnichtausgeschlossenwerden.

IndapamidistengverwandtmitThiaziddiuretika,welchewährenddesStillensmiteinerSenkungoder

aucheinerUnterdrückungdesMilchflussesinZusammenhanggebrachtwurden.Hypersensitivität

gegenüberSulfonamidderivaten,Hypokaliämiekannauftreten.

Amlodipin:

Esistnichtbekannt,obAmlodipinindieMuttermilchausgeschiedenwird.

Fertilität

PerindoprilundIndapamid:

StudienzurReproduktionstoxizitätzeigtenkeineAuswirkungaufdieFertilitätbeiweiblichenund

männlichenRatten(sieheAbschnitt5.3).EssindkeineAuswirkungenaufdiemenschliche

Fruchtbarkeitzuerwarten.

Amlodipin:

BeieinigenPatienten,diemitCalciumkanalblockernbehandeltwordenwaren,wurdenreversible

biochemischeVeränderungenimKopfteilderSpermatozoenbeobachtet.DieklinischenDatenim

HinblickaufeinenmöglichenEinflussvonAmlodipinaufdieFertilitätsindungenügend.Ineiner

StudieanRattenzeigtensichAuswirkungenaufdieFertilitätdermännlichenTiere(sieheAbschnitt

5.3).

4.7 AuswirkungenaufdieVerkehrstüchtigkeitunddieFähigkeitzumBedienenvon

Maschinen

EswurdenkeineStudienzurAuswirkungvonArplexamaufdieVerkehrstüchtigkeitunddieFähigkeit

zumBedienenvonMaschinendurchgeführt.

PerindoprilundIndapamidhabenkeinenEinflussaufdieVerkehrstüchtigkeitunddieFähigkeitzum

BedienenvonMaschinen,aberindividuelleReaktionenaufgrundvonzuniedrigemBlutdruckkönnen

beimanchenPatientenauftreten.

AmlodipinkanngeringebismäßigeAuswirkungenaufdieVerkehrstüchtigkeitunddieFähigkeitzum

BedienenvonMaschinenhaben.FallsPatientenanSchwindel,Kopfschmerz,Müdigkeit,Ermüdung

oderÜbelkeitleiden,kanndieReaktionsfähigkeitbeeinträchtigtsein.

DaherkanndieVerkehrstüchtigkeitoderdasBedienenvonMaschinenbeeinträchtigtsein.Vorsichtist

hierangezeigt,speziellzuBeginnderBehandlung.

4.8 Nebenwirkungen

ZusammenfassungdesSicherheitsprofils

DieamhäufigstenberichtetenNebenwirkungenimZusammenhangmitPerindopril,Indapamidund

Amlodipin,separatangegeben,waren:Schwindel,Kopfschmerzen,Parästhesien,Vertigo,

Schläfrigkeit,Sehverschlechterung,Tinnitus,Palpitationen,Flush,Hypotonie(undAuswirkungenin

ZusammenhangmitHypotonie),Husten,Dyspnoe,gastrointestinaleStörungen(abdominale

Schmerzen,Verstopfung,Diarrhö,Geschmacksstörungen,Übelkeit,Dyspepsie,Erbrechen),Pruritus,

Hautauschlag,makulopapuläreEruptionen,Muskelspasmen,Knöchelschwellung,Asthenie,Ödeme

undMüdigkeit.

TabellarischeZusammenstellungderNebenwirkungen

FolgendeNebenwirkungenwurdenunterderBehandlungmitPerindopril,IndapamidoderAmlodipin

beobachtetundsindnachfolgendenHäufigkeitengeordnet:

Sehrhäufig( 1/10),häufig(1/100,<1/10),gelegentlich(1/1.000,<1/100),selten(1/10.000,

<1/1.000),sehrselten(<1/10.000),nichtbekannt(HäufigkeitaufGrundlagederverfügbarenDaten

nichtabschätzbar).

Häufigkeit MedDRA

Systemorganklasse UnerwünschteWirkungen

Perindopril Indapamid Amlodipin

Infektionenund

parasitäre

Erkrankungen Rhinitis Sehrselten Gelegentlich

Eosinophilie Gelegentlich* - -

Agranulozytose(sieheAbschnitt4.4) Sehrselten Sehrselten -

AplastischeAnämie - Sehrselten

Panzytopenie Sehrselten - -

Leukopenie Sehrselten Sehrselten Sehrselten

Neutropenie Sehrselten - -

HämolytischeAnämie Sehrselten Sehrselten - Erkrankungendes

Blutesunddes

Lymphsystems

Thrombozytopenie Sehrselten Sehrselten Sehrselten

Erkrankungendes

Immunsystems Überempfindlichkeit - Gelegentlich Sehrselten

Hypoglykämie(sieheAbschnitte4.4und

4.5) Gelegentlich* - -

Hyperkaliämie, beiAbsetzender

Therapiereversibel(sieheAbschnitt4.4) Gelegentlich* - - Stoffwechsel-und

Ernaehrungsstörungen

Hyponatriämie(sieheAbschnitt4.4) Gelegentlich* Nicht

bekannt

MedDRA

Systemorganklasse UnerwünschteWirkungen Häufigkeit

Perindopril Indapamid Amlodipin

Hyperglykämie - - Sehrselten

Hyperkalzämie - Sehrselten -

KaliummangelmitHypokaliämie,bei

bestimmtenHochrisikopopulationen

vereinzeltschwerwiegend(siehe

Abschnitt4.4). - Nicht

bekannt -

Schlaflosigkeit - - Gelegentlich

Stimmungsschwankungen(einschließlich

Angst) - - Gelegentlich

Stimmungsstörungen Gelegentlich - -

Depression - - Gelegentlich

Schlafstörung Gelegentlich - - Psychiatrische

Erkrankungen

Verwirrung Sehrselten - Selten

Schwindelgefühl Häufig - Häufig

Kopfschmerz Häufig Selten Häufig

Parästhesien Häufig Selten Gelegentlich

Vertigo Häufig Selten -

Schläfrigkeit Gelegentlich* - Häufig

Hypästhesie - - Gelegentlich

Geschmacksstörung Häufig - Gelegentlich

Tremor - - Gelegentlich

Synkope Gelegentlich* Nicht

bekannt Gelegentlich

Hypertonie - - Sehrselten

PeriphereNeuropathie - - Sehrselten

ExtrapyramidaleErkrankung

(extrapyramidalesSyndrom) - - Nicht

bekannt Erkrankungendes

Nervensystems

Schlaganfall,möglicherweisesekundärzu

einerexzessivenHypotoniebei

Hochrisikopatienten(sieheAbschnitt4.4) Sehrselten -

Sehverschlechterung Häufig Nicht

bekannt Gelegentlich

Augenerkrankungen

Diplopie - - Gelegentlich

Myopie - Nicht

bekannt -

VerschwommenesSehen - Nicht

bekannt -

ErkrankungendesOhrs

unddesLabyrinths Tinnitus Häufig - Gelegentlich

Palpitationen Gelegentlich* - Häufig

Tachykardie Gelegentlich* - -

Anginapectoris(sieheAbschnitt4.4) Sehrselten - -

Arrhythmie(einschließlichBradykardie,

ventrikuläreTachykardienund

Vorhofflimmern) Sehrselten Sehrselten Sehrselten

Myokardinfarkt,möglicherweise

sekundärzueinerexzessivenHypotonie

beiHochrisikopatienten(sieheAbschnitt

4.4) Sehrselten - Sehrselten Herzerkrankungen

Torsadedepointes(potenzielltödlich)

(sieheAbschnitte4.4und4.5). - Nicht

bekannt -

Flush - - Häufig

Gefäßerkrankungen

Hypotonie(undAuswirkungenin Häufig SehrseltenGelegentlich

MedDRA

Systemorganklasse UnerwünschteWirkungen Häufigkeit

Perindopril Indapamid Amlodipin

ZusammenhangmitHypotonie)(siehe

Abschnitt4.4)

Vaskulitis Gelegentlich* - Sehrselten

Husten(seesection4.4) Häufig - Sehrselten

Dyspnoe Häufig - Gelegentlich

Bronchospasmen Gelegentlich - - Erkrankungender

Atemwege,des

Brustraumsund

Mediastinums

EosinophilePneumonie Sehrselten - -

AbdominaleSchmerzen Häufig - Häufig

Verstopfung Häufig Selten Gelegentlich

Diarrhoe Häufig - Gelegentlich

Geschmacksstörungen Häufig - -

Dyspepsie Häufig - Gelegentlich

Übelkeit Häufig Selten Common

Erbrechen Häufig GelegentlichGelegentlich

TrockenerMund Gelegentlich Selten Gelegentlich

Änderungder

Darmentleerungsgewohnheiten - - Gelegentlich

Gingivahyperplasie - - Sehrselten

Pankreatitis Sehrselten Sehrselten Sehrselten Erkrankungendes

Gastrointestinaltrakts

Gastritis - - Sehrselten

Hepatitis(sieheAbschnitt4.4) Sehrselten Nicht

bekannt Sehrselten

Ikterus - - Sehrselten

AnomaleLeberfunktion - Sehrselten - Leber-und

Gallenerkrankungen ImFalleeinerLeberinsuffizienzbesteht

dieMöglichkeitdesAuftretenseiner

hepatischenEnzephalopathie(siehe

Abschnitte4.3und4.4) - Nicht

bekannt -

Pruritus Häufig - Gelegentlich

Ausschlag Häufig - Gelegentlich

Ausschlagmakulo-papulös Häufig -

Urtikaria(sieheAbschnitt4.4) Gelegentlich SehrseltenSehrselten

Angioödem(sieheAbschnitt4.4) Gelegentlich Sehrselten Sehrselten

Alopezie - - Gelegentlich

Purpura - GelegentlichGelegentlich

Hautverfärbungen - - Gelegentlich

VermehrtesSchwitzen Gelegentlich - Gelegentlich

Exanthem - - Gelegentlich

Photosensibilitätsreaktionen Gelegentlich* Nicht

bekannt

(sieheAb-

schnitt4.4) Sehrselten

Pemphigoid Gelegentlich*

Erythemamultiforme Sehrselten - Sehrselten

Stevens-JohnsonSyndrom - Sehrselten Sehrselten

ExfoliativeDermatitis - - Sehrselten

Epidermolysisacutatoxica - Sehrselten -

ErkankungenderHaut

unddes

Unterhautzellgewebes

MöglichkeiteinerVerschlechterungeines

vorbestehendenLupuserythematodes

dissiminatus - Nicht

bekannt -

Muskelspasmen Häufig - Gelegentlich Skelettmuskulatur-,

Bindegewebs-und

Knochenerkrankungen Knöchelschwellung - - Häufig

MedDRA

Systemorganklasse UnerwünschteWirkungen Häufigkeit

Perindopril Indapamid Amlodipin

Arthralgie Gelegentlich* - Gelegentlich

Myalgie Gelegentlich* - Gelegentlich

Rückenschmerzen - - Gelegentlich

Miktionsstörungen,Nykturie,Pollakisurie - - Gelegentlich

AkutesNierenversagen Sehrselten - - Erkrankungender

NierenundHarnwege

Nierenversagen Gelegentlich

Sehrselten -

ErektileDysfunktion Gelegentlich - Gelegentlich Erkrankungender

Geschlechtsorganeund

derBrustdruese Gynäkomastie - - Gelegentlich

Asthenia Häufig - Gelegentlich

Müdigkeit - Selten Häufig

Ödeme - - Häufig

Brustschmerzen Gelegentlich* - Gelegentlich

Schmerzen - - Gelegentlich

Malaise Gelegentlich* - Gelegentlich

PeriphereÖdeme Gelegentlich* - - Allgemeine

Erkrankungenund

Beschwerdenam

Verabreichungsort

Fieber Gelegentlich* - -

Gewichtszunahme,Gewichtsabnahme - - Gelegentlich

Blutharnstofferhöht Gelegentlich* - -

KreatininimBluterhöht Gelegentlich* - -

BilirubinimBluterhöht Selten - -

Leberenzymwerteerhöht Selten Nicht

bekannt -

HämoglobinundHämatokriterniedrigt

(sieheAbschnitt4.4) Sehrselten - -

QTverlängertesElektrokardiogramm

(sieheAbschnitte4.4und4.5) - Nicht

bekannt -

Blutzuckererhöht - Nicht

bekannt - Untersuchungen

HarnsäureimBluterhöht - Nicht

bekannt -

Verletzung,Vergiftung

unddurchEingriffe

bedingte

Komplikationen Sturz Gelegentlich* - -

*DieHäufigkeitfürunerwünschteEreignisseausSpontanberichtenwurdeanhandvonDatenausklinischen

Studienberechnet.

MeldungdesVerdachtsaufNebenwirkungen

DieMeldungdesVerdachtsaufNebenwirkungennachderZulassungistvongroßerWichtigkeit.Sie

ermöglichteinekontinuierlicheÜberwachungdesNutzen-Risiko-VerhältnissesdesArzneimittels.

AngehörigevonGesundheitsberufensindaufgefordert,jedenVerdachtsfalleinerNebenwirkungüber

dasnationaleMeldesystemanzuzeigen:

BundesamtfürSicherheitimGesundheitswesen

Traisengasse5

1200WIEN

ÖSTERREICH

Fax:+43(0)5055536207

Website: http://www.basg.gv.at/

4.9 Überdosierung

EsgibtkeineInformationzurÜberdosierungvonArplexambeimMenschen.

Perindopril/Indapamid

Symptome

DiewahrscheinlichsteNebenwirkungimFalleeinerÜberdosierungistHypotonie,diemanchmalmit

Übelkeit,Erbrechen,Krämpfen,Schwindelgefühl,Schläfrigkeit,Verwirrungszustände,Oliguriebis

hinzurAnurie(hypovolämischbedingt)verbundenseinkann.EskönnenStörungendesWasser-

Elektrolyt-Haushaltsauftreten(niedrigeNatriumspiegel,niedrigeKaliumspiegel).

Behandlung

DieerstenMaßnahmenzursofortigenEliminationdesArzneimittelssinddieEntgiftungdurch

Magenspülungund/oderVerabreichungvonAktivkohleunddanachdieWiederherstellungvon

Flüssigkeit-undElektrolyt-HaushaltineinemdaraufspezialisiertenZentrumbiszurNormalisierung.

SollteeinestarkeHypotonieauftreten,sokanndiesdamitbehandeltwerden,dassderPatientin

RückenlagemitdemKopfnachuntengelagertwird.Wennnötigkanneineintravenöseisotonische

KochsalzlösungverabreichtwerdenodereineandereMethodezurVolumenexpansionkann

angewendetwerden.

Perindoprilat,dieaktiveFormvonPerindopril,istdialysierbar(sieheAbschnitt5.2).

Amlodipin

ErfahrungenmitFällenvonbeabsichtigterÜberdosierungbeimMenschenistlimitiert.

Symptome

DievorliegendenDatenlassenvermuten,dasseineschwerwiegendeÜberdosierungzueiner

ausgeprägtenperipherenVasodilatationundmöglicherweiseReflextachykardieführenkann.

AusgeprägteundwahrscheinlichprolongiertesystemischeHypotonie,imExtremfallbiszumSchock,

derauchtödlichseinkann,wurdeberichtet.

Behandlung

EinedurchAmlodipinüberdosierungverursachteklinischrelevanteHypotonieerfordertaktiveherz-

undkreislaufstützendeMaßnahmensowieeineengmaschigeÜberwachungderkardialenund

respiratorischenFunktionen,HochlagerungderArmeundBeineunddieÜberwachungdes

zirkulierendenFlüssigkeitsvolumensundderUrinausscheidung.

ZurWiederherstellungdesGefäßtonusunddesBlutdruckskanneinVasokonstriktornützlichsein,

sofernkeineKontraindikationfürdieAnwendungbesteht.IntravenösverabreichtesCalciumglukonat

kannzurAufhebungderEffektederCalcium-Kanal-BlockadevonNutzensein.

IneinigenFällenkanneineMagenspülungsinnvollsein.BeigesundenProbandenkonntegezeigt

werden,dassdieGabevonAktivkohleinnerhalbvon2StundennachEinnahmevon10mgAmlodipin

dieResorptionsratevonAmlodipinreduzierte.

DaAmlodipinsehrstarkanPlasmaproteinegebundenwird,isteineDialysevoraussichtlichnichtvon

Nutzen.

5. PHARMAKOLOGISCHEEIGENSCHAFTEN

5.1 PharmakodynamischeEigenschaften

PharmakotherapeutischeGruppe:ACE–Hemmer,andereKombinationen.ACE-Hemmer,

CalciumkanalblockerundDiuretika.ATCCode:C09BX01

ArplexamisteineKombinationaus3antihypertensivenKomponentenmitsichergänzendem

MechanismusumdenBlutdruckbeiPatientenmitHypertoniezukontrollieren.Perindopril-Arginin

SalzisteinACE-Hemmer,IndapamideinChlorosulfamoyl-DiuretikumundAmlodipin,ein

CalciumkanalblockervomDihydropyridin-Typ.

DiepharmakologischenEigenschaftenvonArplexambestehenausdenEigenschaftenjedesder

einzelnenBestandteile.AußerdemerzeugtdieKombinationvonPerindopril/Indapamideineadditive

WirkungdesantihypertensivenEffektsderbeidenKomponenten.

Wirkmechanismus

Perindopril:

PerindoprilisteinHemmerdesAngiotensinConvertingEnzymes(ACE-Hemmer),welcherdas

AngiotensinIinAngiotensinII,einevasopressorischeSubstanz,umwandelt.Zusätzlichstimuliertdas

EnzymdieSekretionvonAldosterondurchdieNebennierenrindesowiedenAbbauvonBradykinin,

einervasodilatatorischenSubstanz,ininaktiveHeptapeptide.

Darausfolgt:

-eineVerminderungderAldosteronsekretion,

-eineSteigerungderPlasma-Reninaktivität,dadasAldosteronkeinenegativeRückkoppelungmehr

ausübt,

-einRückgangdesperipherenGesamtwiderstandsmitbevorzugterWirkungaufMuskel-und

Nierengefäße,ohnedasseineWasser-undSalzretentionodereineReflextachykardiebei

chronischerBehandlungauftritt.

DieantihypertensiveWirkungvonPerindopriltrittauchbeiPatientenmitniedrigenodernormalen

Reninkonzentrationenauf.

PerindoprilwirktdurchseinenaktivenMetaboliten,dasPerindoprilat.DieanderenMetabolitensind

inaktiv.

PerindoprilreduziertdieHerzarbeit:

-durchdievasodilatatorischeWirkungaufdieVenen,wahrscheinlichverursachtdurcheine

VeränderungdesProstaglandin-Metabolismus:VerringerungderVorlast,

-durchdieVerringerungdesgesamtenperipherenWiderstandes:VerringerungderNachlast.

Studien,welchebeiPatientenmitHerzinsuffizienzdurchgeführtwurden,habengezeigt:

-einenRückgangdeslinks-undrechtsventrikulärenFüllungsdrucks,

-eineVerringerungdestotalenperipherenvaskulärenGesamtwiderstands,

-eineSteigerungdescardialenoutputsundeineVerbesserungdesHerzindex,

-eineSteigerungdesregionalenBlutflussesimMuskel.

AuchdieBelastungstestszeigtenVerbesserungen.

Indapamid:

IndapamidisteinSulfonamidderivatmitIndolringundpharmakologischmitderGruppeder

Thiaziddiuretikaverwandt.IndapamidhemmtdieReabsorptionvonNatriumimkortikalen

Verdünnungssegment.

DieserhöhtdieHarnausscheidungvonNatriumundChloridenundingeringeremUmfangdie

AusscheidungvonKaliumundMagnesium,wasdadurchzueinerErhöhungderausgeschiedenen

HarnmengeundeinerantihypertensivenWirkungführt.

Amlodipin:

AmlodipinisteinCalciumkanalblockervomDihydropyridin-Typ,derdentransmembranenEinstrom

vonCalciumionenindieHerzmuskelzellenundglattenGefäßmuskelzellenhemmt(Blockadeder

langsamenCalciumkanäle;Calciumantagonist).

PharmakodynamischeEffekte

Perindopril/Indapamid:

BeimhypertensivenPatientenübtdiePerindopril/IndapamidKombinationunabhängigvomAltereine

dosisabhängigeantihypertensiveWirkungaufdendiastolischenundsystolischenBlutdruckwährend

demLiegenoderStehenaus.WährendklinischerStudienführtediegleichzeitigeGabevon

PerindoprilundIndapamidzueinersynergistischenantihypertensivenWirkungimVergleichzur

separatenVerabreichungdereinzelnenWirkstoffe.

Perindopril:

PerindoprilistinallenStadienderHypertoniewirksam:beileichter,mäßiger,aberauchschwerer.Im

LiegenwieimStehenisteinRückgangdessystolischenunddiastolischenBlutdruckszuverzeichnen.

DiemaximaleantihypertensiveWirkungwird4bis6StundennacheinmaligerEinnahmeerreichtund

bleibt24Stundenlangbestehen.

EsbestehteinehoheRestblockadedesAC-Enzyms,nach24Stundenungefähr80%.

BeiPatienten,dieaufdieBehandlungansprechen,tritteineNormalisierungdesBlutdrucksinnerhalb

einesMonateseinundbleibtohneTachyphylaxiebestehen.

DerAbbruchderBehandlunghatkeinenhypertensivenRebound-Effekt.

PerindoprilbesitztvasodilatatorischeEigenschaften,stelltdieElastizitätdergroßenArterienwieder

her,korrigierthistomorphometrischeVeränderungeninWiderstandsgefäßenundbewirkteine

ReduktionderlinksventrikulärenHypertrophie.

BeiBedarfführtdiezusätzlicheAnwendungeinesThiaziddiuretikumszueineradditivenSynergie.

DieKombinationeinesACE-HemmersundeinesThiaziddiuretikumsvermindertdasbeialleiniger

AnwendungeinesDiuretikumsbestehendeHypokaliämierisiko.

Indapamid:

IndapamidalsMonotherapiehateineantihypertensive,24StundenanhaltendeWirkung.Diese

WirkungtrittbeiDosenauf,unterdenendiediuretischenEigenschaftenschwachinErscheinung

treten.

DieantihypertensiveWirkungistproportionalderVerbesserungderarteriellenComplianceundder

VerringerungdesgesamtenundarteriolärenperipherenGefäßwiderstands.

IndapamidreduziertdielinksventrikuläreHypertrophie.

WenneineDosisThiaziddiuretikaundThiazidähnlicheDiuretikaüberschrittenwird,erreichtdie

antihypertensiveWirkungeinPlateau,wobeidieNebenwirkungenweiterzunehmen.Wenndie

Behandlungerfolglosist,darfdieDosisnichterhöhtwerden.Weiterswurdebeihypertensiven

Patientenkurz-,mittel-undlangfristignachgewiesen,dassIndapamid

-keineWirkungaufdenFettstoffwechselhat:Triglyceride,LDL-CholesterinundHDL-Cholesterin

-keineWirkungaufdenKohlenhydratstoffwechselhat,selbstbeidiabetischen,hypertensiven

Patienten.

Amlodipin:

DieblutdrucksenkendeWirkungvonAmlodipinberuhtaufderdirektenrelaxierendenWirkungauf

dieglatteGefäßmuskulatur.DiegenaueWirkungsweise,durchdieAmlodipinantianginöswirkt,ist

nochnichtvollständigbekannt,aberAmlodipinverringertdietotaleIschämiedurchfolgendezwei

Wirkungen:

AmlodipinerweitertdieperiphereArteriolenunddamitwirdderperiphereWiderstand(Nachlast),

gegendendasHerzarbeitenmuss,gesenkt.DadieHerzfrequenzstabilbleibt,verringertdiese

EntlastungdesHerzensdenmyokardialenEnergieverbrauchunddenSauerstoffbedarf.

WahrscheinlichbewirktAmlodipineineDilatationvonkoronarenArterienundArteriolen,sowohlin

normalenalsauchinischämischenBereichen.DurchdieseDilatationwirddiemyokardiale

SauerstoffversorgungbeiPatientenmitSpasmenderKoronararterien(Prinzmetal-odervasospastische

Angina)verstärkt.

BeiHypertonikernführtdieeinmaltäglicheGabezueinersignifikantenSenkungdesBlutdrucksim

LiegenundimStehenüber24Stunden.AufgrunddeslangsamenWirkungseintrittsistbei

AmlodipingabenichtmitakutemBlutdruckabfallzurechnen.

UnterAmlodipinkameszukeinenunerwünschtenmetabolischenWirkungenoderzuVeränderungen

derLipidwertundeskannbeiPatientenmitAsthma,DiabetesundGichtangewendetwerden.

KlinischeWirksamkeitundSicherheit

ArplexamwurdenichtaufMorbiditätundMortalitätuntersucht.

Perindopril/Indapamid:

PICXEL,einemultizentrische,randomisierte,doppelblind-undaktivkontrollierteStudiebelegte

mittelsEchokardiographiedieWirkungderPerindopril/IndapamidKombinationbeilinksventrikulärer

Hypertrophie(LVH)gegenübereinerEnalaprilMonotherapie.

InPICXELwurdenHypertonikermiteinerLVH(definiertalslinksventrikulärerMassenindex

(LVMI)>120g/m 2 beiMännernund>100g/m 2 beiFrauen)mitPerindoprilTert-Butylamin2mg

(entsprechend2,5mgPerindopril-Arginin)/Indapamid0,625mgoderEnalapril10mgeinmaltäglich

füreineBehandlungvoneinemJahrrandomisiert.DieDosiswurdederBlutdruckkontrolleangepasst,

erhöhtbis8mgPerindoprilTert-Butylamin(entsprechend10mgPerindopril-Arginin)und2,5mg

Indapamidoder40mgEnalaprileinmaltäglich.Nur34%derPatientenwurdenweiterhinmit

PerindoprilTert-Butylamin2mg(entsprechend2,5mgPerindopril-Arginin)/Indapamid0,625mg

behandelt(versus20%mitEnalapril10mg).

AmEndederBehandlungkameszueinersignifikantenAbnahmedesLVMIinder

Perindopril/IndapamidGruppe(-10.1g/m²)gegenüberderEnalaprilGruppe(-1.1g/m²)innerhalbder

gesamtenrandomisiertenPatientenpopulation.DerUnterschiedzwischendenGruppenbzgl.der

LVMIÄnderungbetrug-8,3(95%CI(-11.5,-5.0),p<0,0001).

DieerreichteWirkungbezüglichdesLVMIwarbeihöherenDosenvonPerindopril/Indapamidgrößer

alsfürPerindopril/Indapamid2,5mg/0,625mgundPerindopril/Indapamid5mg/1,25mgzugelassene.

HinsichtlichdesBlutdrucksbetrugderberechneteMittelwertderDifferenzzwischendenGruppenin

derrandomisiertenPopulation-5.8mmHg(95%CI(-7.9,-3.7),p<0.0001)fürdensystolischen

Blutdruckbzw.-2.3mmHg(95%CI(-3.6,-0.9),p=0.0004)fürdendiastolischenBlutdruck,zu

GunstenderPerindopril/IndapamidGruppe.

DieADVANCEStudiewareinmultizentrischer,internationaler,randomisierter,2x2faktoriell

geplanterTestmitdemZielzurBestimmungdesNutzensderBlutdrucksenkungmitder

FixkombinationPerindopril/IndapamidgegenPlaceboanderSpitzederaktuellenStandardtherapie

(doppelblinderVergleich)undvonGliclazidMRbasierterintensiverGlukosekontrolleStrategie

(HbA1cZielvon6,5%oderniedriger)gegeneineStandardGlukosekontrolle(PROBE[Prospective

RandomisedOpenstudywithBlindedEvaluation]design)beigrößerenmakrovaskulärenund

mikrovaskulärenEreignissenbeiTyp2Diabetikern.

DerprimäreEndpunktwardieKombinationausgrößerenmakrovaskulären(kardiovaskulärerTod,

nichttödlichemMyokardinfarkt,nichttödlichemSchlaganfall)undmikrovaskulären(neueoder

verschlechterndeNephropathieundAugenerkrankung)Ereignissen.

Insgesamtwaren11140Typ2Diabetiker(Mittelwerte:Alter66Jahre,BMI28kg/m2,Dauerdes

Diabetes8Jahre,HbA1c7,5%undSBP/DBP145/81mmHg)andemTestbeteiligt.Unterihnen

waren83%hypertensiv,32%und10%zeigteneineVorgeschichtevonmakro-odermikrovaskulärer

Erkrankungund27%hattenMicroalbuminurie.BegleitendeTherapienenthieltenblutdrucksenkende

Mittel(75%),lipidsenkendeMittel(35%hauptsächlichStatine28%),Aspirinoderandere

Plättchenhemmer(47%).

NacheinerLaufzeitvon6WochenanoffenerPerindopril/IndapamidKombinationundüblicher

glukosesenkenderBehandlung,wurdendiePatientenzufälligdemPlacebo(n=5571)oderder

Perindopril/IndapamidKombination(n=5569)zugeteilt.

NacheinerdurchschnittlichenDauerderNachbeobachtungvon4,3Jahren,resultiertedieBehandlung

mitPerindopril/IndapamidineinersignifikantenrelativenRisikoReduktionvon9%beimprimären

Endpunkt(95%CI[0,828;0,996],p=0,041).

DieserNutzenlagbeieinersignifikantenrelativenRisikoReduktionvon14%beidertotalen

Mortalität(95%CI[0,75;0,98],p=0,025),von18%beikardiovaskuläremTod(95%CI[0,68;0,98],

p=0,027)undvon21%beitotalenNierenereignissen(95%CI[0,74;0,86],p<0,001)inderPerindopril/

IndapamidGruppeverglichenmitderPlaceboGruppe.

InderUntergruppenachInteressebeihypertensivenPatienten,wareinerelativeRisikoReduktionvon

9%beidenkombiniertengrößerenmakrovaskulärenundmikrovaskulärenEreignisseninder

Perindopril/IndapamidGruppeverglichenmitderPlaceboGruppe(95%CI[0,82;1,00],p=0,052).

EswaraucheinesignifikanterelativeRisikoReduktionvon16%beidertotalenMortalität(95%CI

[0,73;0,97],p=0,019),von20%beikardiovaskuläremTod(95%CI[0,66;0,97],p=0,023)undvon

20%beitotalenNierenereignissen(95%CI[0,73;0,87],p<0,001)inderPerindopril/Indapamid

GruppeverglichenmitderPlaceboGruppe.

DieVorteilederblutdrucksenkendenInterventionwarenunabhängigvondenen,dieindermit

intensiverGlukosekontrolleStrategiebeobachtetwurden.

Amlodipin:

UmneuereTherapieansätzezuvergleichen,wurdendieAuswirkungenaufMortalitätundMorbidität

ineinerrandomisiertendoppelblindenStudieuntersucht(AntihypertensiveandLipid-Lowering

TreatmenttoPreventHeartAttackTrial,ALLHAT):täglich2,5bis10mgAmlodipin

(Calciumkanalblocker)odertäglich10bis40mgLisinopril(ACE-Hemmer)alsFirst-Line-Therapie

imVergleichmitdemThiaziddiuretikumChlortalidon(12,5bis25mgtäglich)beileichterbis

mittelschwererHypertonie.

IndieseStudiewurdeninsgesamt33.357HypertoniepatientenabeinemAltervon55Jahren

eingeschlossenundüberdurchschnittlich4,9Jahrebeobachtet.Siehattenmindestenseinen

zusätzlichenRisikofaktorfüreinekoronareHerzkrankheit,einschließlichMyokardinfarktoder

ApoplexinderAnamnese(>sechsMonatevorEinschlussindieStudie)odereineandere

nachgewieseneatherosklerotischeHerz-Kreislauferkrankung(insgesamt51,5%),Typ2Diabetes

(36,1%),HDL-C<35mg/dl(11,6%),durchEKGoderEchokardiographiebestätigte

linksventrikuläreHypertrophie(20,9%),Zigarettenraucher(21,9%).

DerprimäreEndpunktwardieKombinationausToddurchkoronareHerzkrankheitundnicht

tödlichemMyokardinfarkt.ZwischenderAmlodipintherapieundderChlortalidontherapieergabsich

hinsichtlichdesprimärenEndpunktskeinsignifikanterUnterschied(RR0,98;95%-KI0,90bis1,07;

p=0,65).BeidensekundärenEndpunktenwardieHäufigkeitvonHerzinsuffizienz(Bestandteileines

zusammengesetztenkardiovaskulärenEndpunkts)inderAmlodipingruppeimVergleichmitder

Chlortalidongruppesignifikanthöher(10,2%vs.7,7%;RR1,38;95%-KI[1,25bis1,52];p<

0,001).BeiderGesamtmortalitätgabesjedochzwischenderAmlodipintherapieundder

ChlortalidontherapiekeinesignifikantenUnterschiede(RR0,96;95%-KI[0,89bis1,02];p=0,20).

DatenausklinischenStudienzurdualenBlockadedesRenin-Angiotensin-Aldosteron-Systems(RAAS):

Inzweigroßenrandomisierten,kontrolliertenStudien(„ONTARGET”[ONgoingTelmisartanAlone

andincombinationwithRamiprilGlobalEndpointTrial]und„VANEPHRON-D”[TheVeterans

AffairsNephropathyinDiabetes])wurdediegleichzeitigeAnwendungeinesACE-Hemmersmit

einemAngiotensin-II-Rezeptor-Antagonistenuntersucht.

Die„ONTARGET“–StudiewurdebeiPatientenmiteinerkardiovaskulärenodereiner

zerebrovaskulärenErkrankunginderVorgeschichteodermitDiabetesmellitusTyp2mit

nachgewiesenenEndorganschädendurchgeführt.Die„VANEPHRON-D“-StudiewurdebeiPatienten

mitDiabetesmellitusTyp2unddiabetischerNephropathiedurchgeführt.

DieseStudienzeigtenkeinensignifikantenvorteilhaftenEffektaufrenaleund/oderkardiovaskuläre

EndpunkteundMortalität,währendeinhöheresRisikofürHyperkaliämie,akuteNierenschädigung

und/oderHypotonieimVergleichzurMonotherapiebeobachtetwurde.Aufgrundvergleichbarer

pharmakodynamischerEigenschaftensinddieseErgebnisseauchaufandereACE-Hemmerund

Angiotensin-II-Rezeptor-Antagonistenübertragbar.

AusdiesemGrundsolltenACE-HemmerundAngiotensin-II-Rezeptor-AntagonistenbeiPatientenmit

diabetischerNephropathienichtgleichzeitigangewendetwerden.

Inder„ALTITUDE“-Studie(AliskirenTrialinType2DiabetesUsingCardiovascularandRenal

DiseaseEndpoints)wurdeuntersucht,obdieAnwendungvonAliskirenzusätzlichzueiner

StandardtherapiemiteinemACE-HemmeroderAngiotensin-II-Rezeptor-AntagonistenbeiPatienten

mitDiabetesmellitusTyp2sowiechronischerNierenerkrankungund/oderkardiovaskulärer

ErkrankungeinenZusatznutzenhat.DieStudiewurdewegeneineserhöhtenRisikosunerwünschter

Ereignissevorzeitigbeendet.SowohlkardiovaskuläreTodesfällealsauchSchlaganfälletrateninder

Aliskiren-GruppenumerischhäufigeraufalsinderPlacebo-Gruppe,ebensounerwünschteEreignisse

und besondere schwerwiegende unerwünschte Ereignisse (Hyperkaliämie, Hypotonie,

Nierenfunktionsstörung).

KinderundJugendliche

EsliegenkeineDatenzuArplexambeiKindernvor.

DieEuropäischeArzneimittelAgenturhatdieVerpflichtung,ErgebnissevonStudienmitArplexamin

allenUntergruppenderpädiatrischenBevölkerungbeiHypertonievorzulegen,erlassen(siehe

Abschnitt4.2KinderundJugendliche).

5.2 PharmakokinetischeEigenschaften

Arplexam:

DiegleichzeitigeVerabreichungvonPerindopril/IndapamidundAmlodipinverändertderen

pharmakokinetischenParameterimVergleichzurseparatenEinnahmenicht.

Perindopril:

ResorptionundBioverfügbarkeit

NachoralerAnwendungwirdPerindoprilschnellabsorbiertunddieSpitzenkonzentrationinnerhalb

voneinerStundeerreicht(PerindoprilisteinePro-DrugundPerindoprilatderaktiveMetabolit).Die

HalbwertszeitvonPerindoprilimPlasmaentsprichteinerStunde.DadurchNahrungsaufnahmedie

UmwandlunginPerindoprilatabnimmtunddamitauchdieBioverfügbarkeit,solltePerindopril-

ArgininmorgensvordemEssenalseinmaltäglicheDosisoralangewendetwerden.

Verteilung

DasVerteilungsvolumenfürungebundenesPerindoprilatbeträgtetwa0,2l/kg.DieProteinbindung

vonPerindoprilatzuPlasmaProteinliegtbei20%,inersterLiniezumAngiotensinConverting

Enzyme,diesistaberkonzentrationsabhängig.

Biotransformation

PerindoprilisteinPro-Drug.27%derverabreichtenPerindoprilDosiserreichtdenBlutstromals

aktivesmetabolisiertesPerindoprilat.ZusätzlichzumaktivenPerindoprilatliefertPerindopril5

Metabolite,diejedochalleinaktivsind.DieSpitzenkonzentrationvonPerindoprilatimPlasmawird

innerhalbvon3bis4Stundenerreicht.

Elimination

PerindoprilatwirdüberdenHarnausgeschiedenunddieterminaleHalbwertszeitderungebundenen

Fraktionbeträgtetwa17Stunden,waseinensteady-stateinnerhalbvon4Tagenergibt.

Linearität/Nicht-Linearität

EswurdeeinlinearesVerhältniszwischenderPerindoprildosisundPlasmaexpositionbewiesen.

BesonderePatientengruppen

-ÄlterePersonen:DieEliminationvonPerindoprilatbeiälterenPersonensinkt,ebenfallsbei

PatientenmitHerz-oderNiereninsuffizienz.

-Nierenfunktionsstörung:EineDosisanpassunginAbhängigkeitvomAusmaßderNierenisuffizienz

(Kreatinin-Clearance)istanzustreben.

-ImFalleeinerDialyse:DieClearancevonPerindoprilatbeiDialysebeträgt70ml/min.

-BeiPatientenmitZirrhose:DiePharmakokinetikvonPerindoprilistverändert,diehepatische

ClearancederMuttersubstanzisthalbiert.JedochistdieMengedesgebildetenPerindoprilatsnicht

vermindertunddeshalbistkeineDosisanpassungnotwendig(sieheAbschnitte4.2und4.4).

Indapamid:

Resorption

IndapamidwirdschnellundvollständigausdemVerdauungstraktabsorbiert.

DieSpitzenplasmakonzentrationwirdbeimMenschenca.eineStundenachoralerGabedesProduktes

erreicht.

Verteilung

DiePlasmaproteinbindungbeträgt79%.

BiotransformationundElimination

DieEliminationshalbwertzeitliegtzwischen14und24Stunden(durchschnittlich18Stunden).Die

wiederholteVerabreichungverursachtkeineAkkumulation.

DieAusscheidungerfolgtimwesentlichenüberdenHarn(70%derDosis)undüberdieFaeces

(22%)inForminaktiverMetaboliten.

BesonderePatientengruppen

BeiPatientenmitNiereninsuffizienzsinddiepharmakokinetischenParameterunverändert.

Amlodipin:

ResorptionundBioverfügbarkeit

NachoralerGabetherapeutischerDosenwirdAmlodipingutabsorbiert,wobei

Spitzenkonzentrationennach6bis12Stundenerreichtwerden.DieabsoluteBioverfügbarkeitbeträgt

etwa64bis80%.

DieBioverfügbarkeitvonAmlodipinistunabhängigvonderNahrungsaufnahme.

Verteilung

DasVerteilungsvolumenbeträgtca.21l/kg.Invitro-Versuchehabengezeigt,dassetwa97,5%des

zirkulierendenAmlodipinanPlasmaeiweißegebundensind.

Biotransformation

AmlodipinwirdinderLebergrößtenteilszuinaktivenMetabolitenverstoffwechselt.ImUrinwerden

10%derSubstanzunverändertsowie60%derMetabolitenausgeschieden.

Elimination

DiePlasmaeliminationshalbwertszeitvariiertzwischen35bis50Stundenundermöglichteineeinmal

täglicheDosierung.

BesonderePatientengruppen

-AnwendungbeiälterenPatienten:DieZeitbiszumErreichenderSpitzenplasmakonzentrationen

vonAmlodipinistbeiälterenundjüngerenPersonengleich.EsbestehteineTendenzzu

verzögerterAmlodipin-AusscheidungmitinderFolgeerhöhterAUCundterminaler

EliminationshalbwertszeitbeiälterenPatienten.DieErhöhungderAUCundder

EliminationshalbwertszeitbeiPatientenmitHerzinsuffizienzentsprachdenErwartungeninBezug

aufdieuntersuchteAltersgruppe.

-AnwendungbeieingeschränkterLeberfunktion:ZurAnwendungvonAmlodipinbeiPatientenmit

eingeschränkterLeberfunktionliegensehrbegrenztklinischeDatenvor.Patientenmit

eingeschränkterLeberfunktionzeigeneineverringerteClearancevonAmlodipin,waszueiner

verlängertenHalbwertszeitundeinerumca.40bis60%erhöhtenAUCführt.

5.3 PräklinischeDatenzurSicherheit

Perindopril:

InchronischenperoralenToxizitätsstudien(RattenundAffen)istdasZielorgandieNiere,mit

reversiblerSchädigung.

Mutagenitätwurdewederbeiinvitronochbeiinvivo-Studienbeobachtet.

StudienzurReproduktionstoxikologie(Ratten,Mäuse,Kaninchen,Affen)ergabenkeineAnzeichen

einerEmbryotoxizitätoderTeratogenität.JedochwurdefürdieKlassederACE-Hemmergezeigt,dass

sienachteiligeEffekteinderspätenfetalenEntwicklungausüben,dieinfetalemTodundkongenitalen

EffektenbeiNagernundKaninchenresultieren:NierenschädigungundeinAnstiegderperi-und

postnatalenMortalitätwurdenbeobachtet.DieFertilitätwarwederbeimännlichennochbei

weiblichenRattenbeeinträchtigt.

InLangzeitstudienanRattenundMäusenwurdekeineKanzerogenitätfestgestellt.

Indapamid:

Diehöchstenp.o.verabreichtenDosen(40-bis8000-fachetherapeutischeDosis)zeigtenin

verschiedenenTiermodelleneineExazerbationderdiuretischenEigenschaftenvonIndapamid.Die

HauptvergiftungssymptomeindenakutenToxizitätsstudiennachintravenöserundintraperitonealer

VerabreichungvonIndapamidwarenaufdiepharmakologischeWirkungvonIndapamid

zurückzuführen,z.B.BradypnoeundperiphereVasodilatation.

TestsmitIndapamidaufmutageneundkanzerogeneEigenschaftenzeigtennegativeResultate.

StudienzurReproduktionstoxizitäthabenkeine embryotoxischeoderteratogeneWirkung bei

RattenundMäusenundKaninchengezeigt.

DieFertilitätwurdewederbeimännlichennochbeiweiblichenRattenbeeinträchtigt.

Perindopril/Indapamid:

DieToxizitätderPerindopril/IndapamidKombinationistetwashöheralsdiederEinzelbestandteile.

DieNierenveränderungenscheinenbeiderRattenichtpotenziertzusein.Dennochverursachtdie

KombinationgastrointestinaleToxizitätbeimHundunddietoxischemEffektefürdieMütterscheinen

beiderRatteerhöhtzusein(gegenüberPerindopril).

NichtsdestotrotztretendieseWirkungenjedocherstbeiDosierungenauf,dieweitüberdenzur

TherapieangewendetenDosenliegen.

PräklinischeUntersuchungengetrenntfürPerindoprilundIndapamiddurchgeführt,zeigtenkein

genotoxisches,karzinogenesoderteratogenesPotential.

Amlodipin:

InStudienzurReproduktionstoxizitätwurdenbeiRattenundMäusenbeiDosierungen,dierund50-

malhöherwarenalsdieaufmg/kgbezogeneempfohleneMaximaldosisbeimMenschen,eine

VerzögerungdesGeburtstermins,eineVerlängerungdesGeburtsvorgangsundeineerhöhteperinatale

MortalitätderNachkommenbeobachtet.

BeiDosierungenbiszu10mg/kg/Tag(das8-Fache*derempfohlenenMaximaldosisvon10mgbeim

Menschen,bezogenaufmg/m2)zeigtensichkeineAuswirkungenaufdieFertilitätvonmitAmlodipin

behandeltenRatten(Männchen:über64Tage;Weibchen:14TagevorderPaarung).Ineineranderen

StudieanRatten,indermännlicheRattenüber30TagemitAmlodipinbesilatinDosenbehandelt

wurden,die,bezogenaufmg/kg,mitderDosierungbeimMenschenvergleichbarwaren,wurde

sowohleineAbnahmedesfollikelstimulierendenHormonsunddesTestosteronsimPlasmaalsauch

eineAbnahmederSpermiendichteundeineVerringerungreiferSpermatidenundSertoli-Zellen

gefunden.

BeiRattenundMäusen,dieüberzweiJahreAmlodipininTagesdosenvon0,5,1,25und2,5mg/kgim

Futtererhielten,ergabensichkeineHinweiseaufeineKanzerogenität.DiehöchsteDosis(fürMäuse

gleichvielundfürRattendasDoppelte*derempfohlenenMaximaldosisvon10mgbeimMenschen,

bezogenaufmg/m2)lagnaheandermaximalvonMäusentoleriertenDosis,jedochnichtandervon

Ratten.

MutagenitätsstudienergabenkeinearzneimittelbedingtenWirkungenaufdemGen-oderaufdem

Chromosomenniveau.

*Ausgehendvoneinem50kgschwerenPatienten

6. PHARMAZEUTISCHEANGABEN

6.1 ListedersonstigenBestandteile

Tablettenkern:

Calciumcarbonat-Stärke-Verbindung:Calciumcarbonat90%,vorverkleisterteMaisstärke10%,

MikrokristallineCellulose(E460),

Croscarmellose-Natrium(E468),

Magnesiumstearat(E572),

HochdispersesSiliciumdioxid,

VorverkleisterteStärke

Tablettenfilm :

Glycerol(E422),

Hypromellose6mPa.s(E464),

Macrogol6000,

Magnesiumstearat(E572),

Titandioxide(E171)

6.2 Inkompatibilitäten

Nichtzutreffend.

6.3 DauerderHaltbarkeit

2Jahre.

FürBehältnissemit30FilmtablettenbeträgtdieHaltbarkeitnachdemerstenÖffnen30Tage.

FürBehältnissemit100FilmtablettenbeträgtdieHaltbarkeitnachdemerstenÖffnen100Tage.

6.4 BesondereVorsichtsmaßnahmenfürdieAufbewahrung

FürdiesesArzneimittelsindkeinebesonderenLagerungsbedingungenerforderlich.

6.5 ArtundInhaltdesBehältnisses

10oder30FilmtabletteninPolypropylen-TablettenbehältnismiteinemMengenreguliererausLDPE

undeinemLDPE-StopfenmiteinemTrocknungsmittel.

100FilmtabletteninTablettenbehältnisausHDPEundeinemStopfenausPolypropylenmiteinem

Trocknungsmittel.

Schachtelzu10,30,60(2Tablettenbehältnissezu30),90(3Tablettenbehältnissezu30),100,500

Tabletten(5Tablettenbehältnissezu100).

EswerdenmöglicherweisenichtallePackungsgrößenindenVerkehrgebracht.

6.6 BesondereVorsichtsmaßnahmenfürdieBeseitigung

KeinebesonderenAnforderungen.

7. INHABERDERZULASSUNG

LesLaboratoiresServier

50,rueCarnot

92284Suresnescedex-Frankreich

8. ZULASSUNGSNUMMER(N)

135514

135515

135516

9. DATUMDERERTEILUNGDERZULASSUNG/VERLÄNGERUNGDER

ZULASSUNG

09.04.2014

10. STANDDERINFORMATION

09/2015

VERSCHREIBUNGSPFLICHT/APOTHEKENPFLICHT

Rezept-undapothekenpflichtig

Document Outline

Ähnliche Produkte

Suchen Sie nach Benachrichtigungen zu diesem Produkt

Dokumentverlauf anzeigen

Teilen Sie diese Informationen