LEVETIRACETAM PHARMASWISS 250 MG POTAHOVANÉ TABLETY, POR TBL FLM 50X250MG

Česká republika - čeština - SUKL (Státní ústav pro kontrolu léčiv)

Koupit nyní

Aktivní složka:
LEVETIRACETAM (LEVETIRACETAMUM)
Dostupné s:
PharmaSwiss Česká republika s.r.o., Praha
ATC kód:
N03AX14
Dávkování:
250MG
Léková forma:
Potahovaná tableta
Podání:
Perorální podání
Jednotky v balení:
50, Blistr
Druh předpisu:
Léčiva na lékařský předpis
Stav Autorizace:
R - registrovaný léčivý přípravek.
Registrační číslo:
21/ 732/11-C
Datum autorizace:
0000-00-00

Přečtěte si celý dokument

Příloha č. 2 krozhodnutío registraci sp.zn. sukls192174-7/2010

PŘÍBALOVÁ INFORMACE: INFORMACE PRO UŽIVATELE

LevetiracetamPharmaSwiss250 mgpotahované tablety

LevetiracetamPharmaSwiss500 mgpotahované tablety

LevetiracetamPharmaSwiss750 mgpotahované tablety

LevetiracetamPharmaSwiss1000 mgpotahované tablety

levetiracetamum

Přečtětesi pozorně celoupříbalovou informaci dříve, než začnete tento přípravek užívat.

Ponechte si příbalovou informaci pro případ, že si ji budete potřebovat přečíst znovu.

Máte-li případně jakékoli další otázky, zeptejte se svéholékaře nebo lékárníka.

Tento přípravek byl předepsán Vám. Nedávejte jej žádné další osobě. Mohl by jí ublížit, a to i

tehdy, má-li stejné příznaky jakoVy.

Pokud se kterýkoli z nežádoucích účinků vyskytne v závažné míře, nebo pokud si všimnete

jakýchkoli nežádoucích účinků, které nejsou uvedeny v této příbalové informaci, prosím,

sdělte to svému lékaři nebo lékárníkovi.

V příbalové informaci naleznete:

Co je LevetiracetamPharmaSwissa k čemu se používá

Čemu musíte věnovat pozornost, než začnete přípravek LevetiracetamPharmaSwiss

užívat

Jak se přípravekLevetiracetamPharmaSwissužívá

Možné nežádoucí účinky

Jak přípravekLevetiracetamPharmaSwissuchovávat

Další informace

1. CO JELEVETIRACETAMPHARMASWISSAK ČEMU SE POUŽÍVÁ

LevetiracetamPharmaSwissje lék proti epilepsii (lék určený k léčbě záchvatů u nemocnýchs

epilepsií).

LevetiracetamPharmaSwissse užívá:

osamostatně u pacientů ve věku od 16 let s nově diagnostikovanou epilepsií k léčbě parciálních

(ohraničených) epileptických záchvatů se sekundární generalizací nebo bez ní

ojako přídatná léčba společně s jinými léky proti epilepsii k léčbě:

oparciálních záchvatů se sekundární generalizací nebo bez ní u pacientů ve věku od 1

měsíce věku

omyoklonických záchvatů u pacientů od 12 let věku s juvenilní myoklonickou

epilepsií

oprimárně generalizovaných tonicko-klonických záchvatů u pacientů od 12 let s

idiopatickou generalizovanou epilepsií.

2. ČEMU MUSÍTE VĚNOVAT POZORNOST, NEŽ ZAČNETE PŘÍPRAVEK

LEVETIRACETAM PHARMASWISSUŽÍVAT

NeužívejteLevetiracetamPharmaSwiss,

jestliže jstealergický/á(přecitlivělý/á)nalevetiracetamnebo na jakoukoliv složku

přípravkuLevetiracetamPharmaSwiss.

Zvláštní opatrnosti při užívání přípravku LevetiracetamPharmaSwissje zapotřebí

jestliže máte potížes ledvinami, dbejte pokynů lékaře. Lékař může rozhodnout

o případné úpravě dávkování.

jestliže zpozorujete jakékolizpomalenírůstunebo neočekávaný rozvoj puberty

u Vašeho dítěte, prosím, kontaktujte svého lékaře.

pokud byu Vás došlo kezhoršení záchvatů(např. zvýšenípočtu), prosím,kontaktujte

svého lékaře.

Uněkolika osob léčených antiepileptiky jako jelevetiracetam, se vyskytly myšlenky na

sebepoškození či sebevraždu. Pokud se u Vás objeví jakýkoli příznakdeprese nebo

sebevražedných myšlenek,obraťte se, prosím, na svého lékaře.

Vzájemné působení s dalšími léčivými přípravky

Prosím, informujte svéholékaře nebo lékárníkao všech lécích, které užíváte nebo jste užíval(a)

v nedávné době a to i o lécích, které jsou dostupné bez lékařského předpisu.

Užívání přípravku LevetiracetamPharmaSwisss jídlem a pitím

Přípravek LevetiracetamPharmaSwissmůžete užívat nezávisle na jídle, tj. spolu s jídlem nebo

bez něj. Pro maximální bezpečnost léčby nepožívejte během užívánípřípravku Levetiracetam

PharmaSwissalkohol.

Těhotenství a kojení

Pokud jste těhotná nebo si myslíte, že byste mohla být těhotná, informujte, prosím, svého lékaře.

LevetiracetamPharmaSwissse nesmí užívat během těhotenství, pokud to není naprosto nezbytné.

Není známo možné riziko pro Vaše nenarozené dítě. Ve studiích na zvířatech měl přípravek

LevetiracetamPharmaSwissnežádoucí reprodukční účinky, avšak ve vyšších dávkách než budete

potřebovat k léčbě Vašich záchvatů.

Během léčby se nedoporučuje kojení.

Poraďte se se svým lékařem nebo lékárníkem dříve, než začnete užívat jakýkoli lék.

Řízení dopravních prostředků a obsluha strojů

Neměl(a) byste řídit nebo obsluhovat stroje, dokud se nezjistí, zda Vaše schopnost vykonávat tyto

činnosti není ovlivněna.PřípravekLevetiracetamPharmaSwissmůže narušit Vaši schopnost řídit

vozidlo a obsluhovat stroje a zařízení, protože může způsobit ospalost. K tomu dochází spíše na

začátku léčby nebo po zvýšení dávky.

Důležitá informace o některých látkách přípravku LevetiracetamPharmaSwiss750 mg

BarvivoE 110může vyvolat alergické reakce.

3. JAK SE LEVETIRACETAMPHARMASWISSUŽÍVÁ

Vždy užívejte přípravek Levetiracetam PharmaSwisspřesně podle pokynů Vašeho lékaře. Pokud

sinejste jistý(á), poraďte se se svým lékařem.

Levetiracetam se musí užívat2x denně, jednou ráno a jednou večer, každý den přibližně ve

stejnou dobu.

Vždy užívejte tolik tablet, kolik Vám určí lékař.

Monoterapie

Dávkyu dospělýchamladistvých(od16tilet věku):

Obvyklá dávka:v rozmezí1,000 mg(4 tablety)a 3,000 mg(12 tablet) denně.

Obvyklá dávka:v rozmezí1,000 mg(2 tablety)and 3,000 mg(6 tablet) denně.

Obvyklá dávka:v rozmezí1,000 mg and 3,000 mgdenně.

Obvyklá dávka:v rozmezí1,000 mg and 3,000 mgdenně.

Jestliže dostáváte levetiracetam poprvé, lékař Vám pro první dva týdny předepíšenižší dávku,

než je nejnižší obvyklá dávka.

Příklad:při denní dávce 1 000 mg si musíte vzít dvě tablety ráno a dvě tablety večer.

Příklad: při denní dávce 1000 mg si musíte vzít jednu tabletu ráno a jednu tabletu večer.

Příklad: přidenní dávce 1500 mg si musíte vzít jednu tabletu ráno a jednu tabletu večer.

Příklad: při denní dávce 2000 mg si musíte vzít jednu tabletu ráno a jednu tabletu večer.

Přídatná léčba

Dávkapro dospělé amladistvé(12-17 let) s hmotností alespoň 50 kg:

Obvyklá dávka: v rozmezí 1 000 mg (4 tablety) až 3 000 mg (12 tablet) denně.

Příklad: při denní dávce 1 000 mg si musíte vzít dvě tablety ráno a dvě tablety večer.

Obvyklá dávka: v rozmezí 1000 mg (2 tablety) až 3000 mg (6 tablet) denně.

Příklad: při denní dávce 1000 mg si musíte vzít jednu tabletu ráno a jednu tabletu večer.

Obvyklá dávka: v rozmezí 1000 mg až3000 mg denně.

Příklad: při denní dávce 1500 mg si musíte vzít jednu tabletu ráno a jednu tabletu večer.

Obvyklá dávka: v rozmezí 2000 mg až3000 mg denně

Příklad: při denní dávce 2000 mg si musíte vzít jednu tabletu ráno a jednu tabletu večer.

Dávkapro kojence (6-23 měsíců), děti (2-11 let) a mladiství (12-17 let) s hmotností nižší než

50 kg:

Obvyklá dávka: v rozmezí 20 mg/kg až60 mg/kg tělesné hmotnosti denně. Tato dávka se lépe

podává ve formě perorálního roztoku, který se v závislosti na dávce dodává s 3 ml nebo 10 ml

stříkačkou. Lékař Vám předepíše nejvhodnější lékovou formu levetiracetamu podle tělesné

hmotnosti a dávky.

Příklad: proobvyklou dávka 20 mg/ kg tělesné hmotnosti denně musíte podat dítěti vážícímu 25

kg jednu tabletu ráno a jednu tabletu večer nebo 2,5ml ráno a 2,5 ml večer.

Levetiracetam 100 mg/ml perorální roztok a Levetiracetam 250 mg tablety jsou nejvhodnější

lékovou formou pro kojence a malé děti.

Levetiracetam 100 mg/ml perorální roztok a Levetiracetam 250 mg tablety jsou nejvhodnější

lékovou formou pro kojence a malé děti.

Levetiracetam 100 mg/ml perorální roztok a Levetiracetam 250 mg tablety jsou nejvhodnější

lékovou formou pro kojence a malé děti.

Dávkapro kojence (1 měsícaždoméně než 6 měsíců):

Levetiracetam 100 mg/ml perorální roztok je nejvhodnější lékovou formoupro kojence.

Způsob podání:

Tablety levetiracetamu se polykají s dostatečným množstvím tekutiny (např. zapijtejesklenicí

vody).

Délka léčby:

Levetiracetam je určen k dlouhodobé léčbě. Je třeba pokračovat v léčbě levetiracetamem tak

dlouho, jak Vám doporučil lékař.

Neukončujte léčbu bez porady se svým lékařem, protože by to mohlo vést ke zvýšenému

výskytu záchvatů.Pokud se Váš lékař rozhodne k ukončení léčbylevetiracetamem, doporučí

Vám, jak levetiracetam postupně vysadit.

Jestliže jste užil/a vícetablet přípravku LevetiracetamPharmaSwiss, než jste měl/a

Možné nežádoucí účinky při předávkování přípravkem LevetiracetamPharmaSwissjsou ospalost,

pohybovýneklid, agresivita, snížená bdělost, útlum dýchání abezvědomí.

Jestliže jste užil/a více tablet, než jste měl/a, vyhledejte svého lékaře. Váš lékař určí nejlepší

možnou léčbu předávkování.

Jestliže jste zapomněl/a užít přípravek LevetiracetamPharmaSwiss

Pokud si zapomenete vzít jednu nebo více dávek přípravku LevetiracetamPharmaSwiss,

vyhledejte svého lékaře.Nezdvojujte následující dávku, abyste doplnil/a vynechanou dávku.

Jestliže jste přestal/a užívat přípravek LevetiracetamPharmaSwiss

Nepřestávejte užívat přípravek Levetiracetam PharmaSwiss, dokud Vám to neřekne Váš lékař, a

to ani pokud seuž cítíte dobře.Při ukončování léčby, stejně jako u jiných antiepileptických

přípravků, je nutno vysazovat přípravek postupně, aby se zabránilo zvýšenému výskytu záchvatů.

Máte-li jakékoli další otázky, týkající se užívání tohoto přípravku, zeptejte sesvého lékaře nebo

lékárníka.

4. MOŽNÉ NEŽÁDOUCÍ ÚČINKY

Podobně jako všechny léky může mít i LevetiracetamPharmaSwissnežádoucí účinky, které se

ale nemusí vyskytnout u každého.

Sdělte svému lékaři, pokud se u Vás vyskytnou některé z následujících nežádoucích účinků a

pokud Vás tyto účinky znepokojují.

Některé z nežádoucích účinků jako ospalost, únava nebo závratě se mohou vyskytovat častěji na

začátku léčby nebo při zvýšení dávky. Tyto nežádoucí účinky by ale měly postupně odeznít.

Velmi časté nežádoucí účinky(postihují více než 1 pacienta z 10):

Somnolence (ospalost)

Astenie/slabost (únava)

Časté nežádoucí účinky(postihují 1až10pacientů ze 100)

Infekce, nazofaryngitida (zánět nosohltanu)

Snížený počet krevních destiček

Anorexie (snížení chuti kjídlu), přibývání na váze

Agitovanost(pohybový neklid), deprese, emoční nestabilita/výkyvy nálady, nepřátelství

neboútočnost, nespavost, nervozita nebo podrážděnost, poruchy osobnosti (poruchy

chování), abnormální myšlení (pomalé myšlení, neschopnost soustředění)

Závratě/poruchy rovnováhy, křeče, bolesti hlavy, hyperkineze (zvýšení pohybové

aktivity), ataxie (zhoršená koordinace pohybů), třes (mimovolní chvění), amnézie (ztráta

paměti), poruchy rovnováhy (porucha schopnosti udržet rovnováhu těla), poruchy

soustředění (ztráta schopnosti soustředit se), poruchy paměti (zapomnětlivost)

Diplopie (dvojité vidění), rozostřené vidění

Vertigo (pocit točeníse)

Kašel (zhoršení existujícího kašle)

Bolesti břicha,nevolnost, zažívací potíže, průjem, zvracení

Vyrážka,ekzém, svědění

Bolest svalů

Náhodná poranění

Není známo(četnost z dostupných údajů nelze určit)

Úbytek červených nebo bílých krvinek

Úbytek tělesné hmotnosti

Abnormální chování, hněv, úzkost, zmatenost, halucinace, duševní poruchy, sebevražda,

pokus o sebevraždu a sebevražedné myšlenky

Parestézie (brnění)

Zánět slinivky břišní

Selhání jaterních funkcí, zánět jater, abnormální hodnoty jaterních funkcí

Vypadávání vlasů, puchýře na kůži, v ústech, v okolí očí a na pohlavních orgánech, kožní

vyrážka.

Pokudse kterýkoli z nežádoucích účinků vyskytne v závažné míře, nebo pokud si všimnete

jakýchkoli nežádoucích účinků, které nejsou uvedeny v této příbalové informaci, prosím,

sdělte to svému lékaři nebo lékárníkovi.

5. JAK PŘÍPRAVEKLEVETIRACETAMPHARMASWISSUCHOVÁVAT

Uchovávejte mimo dosah a dohled dětí.

Tento léčivý přípravek nevyžaduje žádné zvláštnípodmínky uchovávání.

Nepoužívejte po uplynutí doby použitelnosti uvedené na papírové krabičce a na blistruza„EXP“.

Doba použitelnosti se vztahuje k poslednímu dni uvedeného měsíce.

Léčivé přípravky se nesmí vyhazovat do odpadních vod nebo domácího odpadu. Zeptejte se

svého lékárníka, jak máte likvidovat přípravky, které již nepotřebujete. Tato opatření pomáhají

chránit životní prostředí.

6. DALŠÍINFORMACE

CoLevetiracetamPharmaSwissobsahuje

Léčivou látkou je levetiracetamum.

Jedna tableta obsahuje 250 mg leveciracetamum.

Jedna tableta obsahuje 500 mg leveciracetamum.

Jedna tableta obsahuje 750 mg leveciracetamum.

Jedna tableta obsahuje 1000 mg leveciracetamum.

Pomocnými látkami jsou:

Jádro tablety : koloidní bezvodý oxid křemičitý,částečně substituovanáhyprolosa,

mikrokrystalickácelulosa, magnesium-stearát.

Potah 250 mg tablety:Opadry II modrý 85F20694

(polyvinylalkohol, macrogol (PEG 3350), mastek, oxid titaničitý (E171), indigokarmin (E132)).

Potah500 mg tablety: Opadry II žlutý85F32004 (olyvinylalkohol, macrogol (PEG 3350), mastek,

oxid titaničitý (E171), žlutý oxid železitý (E172)).

Potah750 mg tablety: Opadry II oranžový 85F23452 (polyvinylalkohol, macrogol (PEG 3350),

mastek, oxid titaničitý (E171), červený oxid železitý (E172), oranžová žluť (E110)).

Potah1000 mg tablety: Opadry II bílý 85F18422 (polyvinylalkohol, macrogol 3350, mastek, oxid

titaničitý (E171)).

JakLevetiracetamPharmaSwissvypadáa co obsahuje toto balení

LevetiracetamPharmaSwiss250 mgjsou modré,oválné bikonvexní potahované tablety spůlicí

rýhou na obou stranáchtabletya svyraženímL9TT/250 na jedné straně.

LevetiracetamPharmaSwiss500 mgjsou žluté,oválné bikonvexní potahované tablety spůlicí

rýhou na obou stranáchtabletya svyraženímL9TT/500 na jedné straně.

LevetiracetamPharmaSwiss750 mg jsou oranžové,oválné bikonvexnípotahované tablety s

půlicírýhou na obou stranáchtabletya svyraženímL9TT/750 na jedné straně.

LevetiracetamPharmaSwiss1000 mg jsou bílé,oválné bikonvexnípotahované tablety spůlicí

rýhou na obou stranáchtabletya svyraženímL9TT na jedné straně a 1000 na straně druhé.

Půlicírýhaje určena pouze kdělení tablety za účelemsnazšíhopolknutí anení určena k dělení

dávky.

Papírové krabičky obsahují 10, 20, 30, 50, 60, 100, 120 nebo 200potahovaných tablet. Na trhu

nemusí být všechny velikosti balení.

Držitel rozhodnutí o registraci a výrobce

Držitel rozhodnutí o registraci:

PharmaSwiss Česká republika s.r.o.

Jankovcova 1569/2c

17000 Praha7

Výrobce:

PharmaSwiss d.o.o., Ljubljana, Slovinsko

Synthon BV, Nijmegen, Nizozemsko

Synthon Hispania S.L., Barcelona, Španělsko

Tatopříbalová informace byla naposledy schválena

16.11.2011

Přečtěte si celý dokument

Příloha č. 3 krozhodnutío registraci sp.zn. sukls192174-7/2010

Souhrn údajů o přípravku

1 NÁZEV PŘÍPRAVKU

LevetiracetamPharmaSwiss250 mgpotahované tablety

LevetiracetamPharmaSwiss500 mgpotahované tablety

LevetiracetamPharmaSwiss750 mgpotahované tablety

LevetiracetamPharmaSwiss1000 mgpotahované tablety

2 KVALITATIVNÍ A KVANTITATIVNÍ SLOŽENÍ

Jedna potahovaná tableta obsahuje 250 mg levetiracetamum.

Jedna potahovaná tableta obsahuje 500 mg levetiracetamum.

Jedna potahovaná tableta obsahuje 750 mg levetiracetamum.

Jedna potahovaná tableta obsahuje 1 000 mg levetiracetamum.

Pomocná látka:

Jedna potahovaná tableta obsahuje 0,31 mg oranžové žluti (E110).

Úplný seznam pomocných látek viz také bod 6.1.

3 LÉKOVÁ FORMA

Potahovanétablety

Modré,oválnébikonvexnípotahovanétabletyspůlicírýhoupooboustranáchtablety

a svyraženímL9TT/250na jedné straně.

Žluté,oválnébikonvexnípotahovanétabletyspůlicírýhounaoboustranáchtablety

asvyraženímL9TT/500 na jedné straně.

Oranžové,oválnébikonvexnípotahovanétabletyspůlicírýhounaoboustranáchtabletyas

vyraženímL9TT/750 na jedné straně.

Bílé,oválnébikonvexnípotahovanétabletyspůlicírýhounaoboustranáchtablety

a svyraženímL9TT na jedné straně a1000 na straně druhé.

Půlicírýhajeurčenapouzekdělenítabletyzaúčelemsnazšíhopolknutíaneníurčenakdělení

dávky.

4 KLINICKÉ ÚDAJE

4.1 Terapeutické indikace

Levetiracetam je indikován jako monoterapie při léčbě parciálních záchvatů s nebo bez

sekundární generalizace u pacientů od 16ti let věku snově diagnostikovanou epilepsií.

Levetiracetam je indikován jako přídatná terapie

při léčbě parciálních záchvatů s nebo bez sekundární generalizace u dospělých, dětí a kojenců

od 1 měsíce věku s epilepsií.

přiléčběmyoklonickýchzáchvatůudospělýchamladistvýchod12letvěkusjuvenilní

myoklonickou epilepsií.

přiléčběprimárníchgeneralizovanýchtonicko-klonickýchzáchvatůudospělýcha

mladistvých od 12 let věku s idiopatickou generalizovanou epilepsií.

4.2 Dávkování a způsob podání

Dávkování

Monoterapie u dospělých a mladistvých od 16 let věku

Doporučená počáteční dávka je 250 mg dvakrát denně, která může být po dvou týdnech zvýšena

na počáteční terapeutickou dávku 500 mg dvakrát denně. Dávka může být dále zvyšována o 250

mgdvakrátdenněkaždédvatýdnyvzávislostinaklinickéodpovědi.Maximálnídávkaje1500

mg dvakrát denně.

Přídatnáterapieudospělých(≥18let)amladistvých(12až17let)shmotnostíalespoň

50 kg nebo více

Počáteční terapeutická dávka je 500 mg dvakrát denně . S touto dávkou lze začít od prvního dne

léčby.V závislosti na klinické odpovědi a snášenlivosti lze denní dávku zvýšit až na 1500 mg

dvakrát denně. Dávku lze měnit o 500 mg dvakrát denně každé

2 až 4 týdny.

Zvláštní skupiny pacientů

Starší pacienti (65 let a starší)

Ustarších pacientů s poruchou renálních funkci (viz níže Pacienti s poruchou renálních funkcí) se

doporučuje dávku upravit.

Pacienti s poruchou renálních funkcí

Denní dávka je nutno upravit dle renálních funkcí.

Prodospělépacientypoužijtenásledujícítabulkuadávkuupravteodpovídajícímzpůsobem.Při

použití této tabulky dávkování je nutno nejprve stanovit pacientovu clearance kreatininu(CLcr) v

ml/min.Udospělých a mladistvýchohmotnosti50 kg avícelzehodnotuCLcrv ml/minzjistitz

hladin kreatininu v séru s použitím následující rovnice:

[140-věk (roky)] x hmotnost (kg)

CLcr (ml/min) =------------------------------------------------- (x 0.85 u žen)

72xhladina kreatininu v séru (mg/dl)

CLcr se pak přepočítá podle následujícího vzorce na povrch těla (body surface area,BSA) :

CLcr (ml/min)

CLcr (ml/min/1.73 m 2 ) =-----------------------------x 1.73

BSA pacienta (m 2 )

Úprava dávky u dospělých pacientů s poruchou renálních funkcí

SKUPINA clearance

kreatininu

(ml/min/1.73m 2 ) Dávkaafrekvence

Normální > 80 500 to1,500 mg dvakrát denně

Mírný 50-79 500 to1,000 mg dvakrát denně

Středně těžký 30-49 250 to750 mg dvakrát denně

Těžký < 30 250 to500 mg dvakrát denně

Dialýzovaní nemocní

v konečném stadiu

onemocnění ledvin(1) - 500 to1,000 mg jednou denně (2)

(1)První den léčby se doporučuje podatúvodní dávku levetiracetamu 750 mg.

(2)Po dialýze se doporučuje podat dodatečnou dávku 250 až500 mg.

U dětí s poruchou funkce ledvin je třeba upravit dávkování levetiracetamu podle renálních funkcí,

protožeclearancelevetiracetamunanichzávisí.Totodoporučeníjezaloženonastudiiu

dospělých s poruchou funkce ledvin.

CLcrvml/min/1.73m 2 můžebýtodhadnutazestanovenísérovéhokreatininu(mg/dl)pro

mladistvé, děti a kojence s použitím následujícího vzorce (Schwarzůvvzorec):

Výška (cm) x ks

CLcr (ml/min/1.73 m 2 ) =----------------------------------------------

Sérový kreatinin (mg/dl)

ks=0.45 pro donošenékojencedo1rokuvěku; ks = 0.55 pro dětimladší než 13let;

ks = 0.7pro dospívající chlapce.

Úprava dávkování pro kojence a dětské pacienty s poruchou funkce ledvin.

Frekvence podávání Skupina Clearance

kreatininu

(ml/min/1.73m 2 ) Děti od 1 do méně než

6 měsíců Děti od 6 do 23 měsíců, děti

amladiství s hmotností pod

50 kg

Normální > 80 7-21 mg/kg (0.07-

0.21 ml/kg) 2x denně 10-30mg/kg (0.10-

0.30ml/kg) 2x denně

Mírný 50-79 7-14 mg/kg (0.07-

0.14 ml/kg) 2x denně 10-20mg/kg (0.10-

0.20ml/kg) 2x denně

Středně těžký 30-49 3.5-10.5 mg/kg (0.035-

0.105 ml/kg) 2x denně 5-15 mg/kg (0.05-

0.15ml/kg) 2x denně

Těžký < 30 3.5-7 mg/kg (0.035-

0.07 ml/kg) 2x denně 5-10 mg/kg (0.05-

0.10ml/kg) 2x denně

Dialýzovaní nemocní

v konečném stadiu

onemocnění ledvin -- 7-14 mg/kg (0.07-0.14

ml/kg) 1x denně (1)(3) 10-20mg/kg (0.10-

0.20ml/kg) 1x denně (2)

(1)Úvodní dávka 10.5 mg/kg (0.105 ml/kg) je doporučována první den léčby

levetiracetamem.

(2)Úvodní dávka 15 mg/kg (0.15 ml/kg) je doporučována první den léčby

levetiracetamem.

(3)Po dialýze se doporučuje dodatečná dávka3.5-7 mg/kg (0.035-0.07 ml/kg).

(4)Po dialýze se doporučuje dodatečná dávka 5-10 mg/kg (0.05-0.10 ml/kg).

Porucha funkce jater

U pacientů s mírnou až střednězávažnouporuchou jaterních funkcí není třeba dávku upravovat.

U nemocných szávažnouporuchou jaterních funkcí může hodnota clearance kreatininu

podhodnocovat renální nedostatečnost. Proto se při hodnotě clearance kreatininu < 60

ml/min/1.73 m doporučuje snížit denní udržovací dávku o 50 %.

Pediatrická populace

Lékař by měl předepsat nejvhodnější lékovou formu, velikost balení a sílu přípravku vzhledem k

hmotnosti pacienta a dávce.

Monoterapie

Bezpečnosta účinnostlevetiracetamuu dětí amladistvýchdo 16tiletnebylyumonoterapie

dosud stanoveny. Nejsou k dispozici žádné údaje

Přídatnáterapieprokojencevevěkuod6do23měsíců,děti(2až11let)amladistvé(12až

17let) s hmotností nižšínež 50 kg

Počáteční terapeutická dávka je 10 mg/kg dvakrát denně.

Vzávislostina klinickéodpovědia snášenlivostilzedávkuzvýšit ažna30mg/kg dvakrát denně.

Změna dávky by neměla překročit zvýšení nebo snížení o 10 mg/kg dvakrát denně každé 2 týdny.

Měla by být použita nejnižší účinná dávka.

Dávka u dětí s hmotností 50 kg a vyšší je stejná jako u dospělých.

Doporučená dávka pro kojence od 6ti měsíců věku, pro děti a mladistvé:

Hmotnost Počáteční dávka:

10 mg/kg 2x denně Maximálnídávka:

30mg/kg2x denně

6 kg (1) 60 mg (0.6 ml) 2x denně 180 mg (1.8 ml) 2x denně

10 kg (1) 100 mg (1 ml) 2x denně 300 mg (3 ml) 2x denně

15 kg (1) 150 mg (1.5 ml) 2x denně 450 mg (4.5 ml) 2x denně

20 kg (1) 200 mg (2 ml) 2x denně 600 mg (6 ml) 2x denně

25 kg 250 mg 2x denně 750 mg 2x denně

Od 50 kg (2) 500 mg 2x denně 1500 mg 2x denně

(1)U dětí s hmotností do 20 kg nebo méně by měl být na počátku léčby pokud možno použit

přípravek levetiracetam 100 mg/ml ve formě perorálního roztoku.

(2)Dávka u dětí a mladistvýchs hmotností 50 kg a vyšší je stejná jako u dospělých.

Přídatná terapie pro kojence ve věku od1 měsíce do věku méně než 6 měsíců

Lékováformatabletynenívhodnápropodáváváníkojencůmmladšímnež6měsíců.

U kojenců se používá léková forma perorálníhoroztoku.

Způsobpodání

Potahovanétabletyjenutnoužívatperorálně,zapíjetdostatečnýmmnožstvímtekutinyalzeje

užívat spolu s jídlem nebobezněj. Denní dávka se podává rozdělena do dvou stejných dávek.

4.3 Kontraindikace

Hypersensitivita na levetiracetam nebo na jiné pyrrolidonové deriváty nebo na kteroukoli

pomocnou látku.

4.4 Zvláštní upozornění aopatření pro použití

Ukončení léčby

Pokudjenutnoukončitléčbupřípravkemlevetiracetam,vsouladusesoučasnouklinickoupraxí

sedoporučujevysazovatjejpostupně(např.udospělýchsnižovánío500mgdvakrátdenně

každé2ažčtyřitýdny;ukojencůstaršíchnež6měsíců,dětíamladistvýchshmotnostínižších

než50kg:dávkabysemělasnižovatnejvýšeo10mg/kgdvakrátdenněkaždédvatýdny;u

kojencůpod6měsícůvěkubysníženídávkynemělopřekročit7mg/kgdvakrátdenněkaždé2

týdny.

Renální insuficience

Podávánílevetiracetamupacientůmsporuchourenálníchfunkcísimůževyžádatúpravudávky.

U nemocných s těžkou poruchou funkce jaterje vhodné před zvolením dávky provést zhodnocení

renálních funkcí (viz bod 4.2).

Sebevražda

Upacientůléčenýchantiepileptiky(včetnělevetiracetamu)bylyhlášenypřípadysebevraždy,

pokusuosebevraždu,sebevražednýchpředstavachování.Meta-analýzarandomizovaných

placebemkontrolovanýchstudiísantiepileptikyprokázalamírnězvýšenérizikosebevražedných

myšlenek a chování. Mechanismus vzniku tohoto rizika není znám.

Z tohoto důvodu by u pacientů měly být sledovány známky deprese nebo sebevražedných

představ a chovánía měla by být zvážena odpovídající léčba.Pacienti (a jejich ošetřovatelé) by

měli být poučeni, aby vyhledali lékařskou pomoc, pokud se projeví deprese nebo sebevražedné

myšlenky či chování.

Pediatrická populace

Léková forma tabletnení vhodná pro kojence do 6 měsíců věku.

Dostupné údaje u dětí nenaznačují vliv na růst ani na pubertu.Nicménědlouhodobý vliv u dětí na

učení, inteligenci, růst, endokrinní funkce, pubertu a plodnost není zatím znám.

Zvýšení četnosti záchvatů o vícenež 25% bylo zaznamenáno u 14% dospělých i dětských

pacientů léčených levetiracetamem (4 až 16 let) s parciálními záchvaty, zatímco bylo hlášeno u

26% a 21% placebem kontrolovaných dospělých a dětskýchpacientů. Pokud byl levetiracetam

použit k léčbě primárně generalizovaných tonicko-klonických záchvatů u dospělých a

mladistvých s idiopatickou generalizovanou epilepsií, nebyl pozorován vliv na frekvenci absencí.

Bezpečnost a účinnost levetiracetamu nebyly dostatečně ověřeny u dětí s epilepsií mladších než 1

rok.Klinickýchstudiíse účastnilopouze 35kojencůmladšíchnež1rokapouze 13znichbylo

ve věku nižším než 6 měsíců.

Pomocné látky

PotahovanétabletypřípravkuLevetiracetamPharmaSwiss750mgobsahujíbarvivoE110,které

může vyvolat alergickéreakce.

4.5 Interakce s jinými léčivými přípravky a jiné formy interakce

Antiepileptika

Datazpremarketingovýchklinickýchstudiíudospělýchukazují,želevetiracetamneovlivňuje

sérovékoncentracejižpodávanýchantiepileptik(fenytoin,karbamazepin,kyselinavalproová,

fenobarbital,lamotrigin,gabapentinaprimidon)ažetatoanti-epileptikaneovlivňují

farmakokinetiku levetiracetamu.

Stejně jako u dospělých není u dětí užívajících levetiracetam do dávky 60 mg/kg/denžádný důkaz

o klinicky významných interakcích tohoto přípravku. Retrospektivní hodnocení

farmakokinetických interakcí u dětí a mladistvých sepilepsií (4-17 let) potvrdilo, že přídatná léčba

perorálněužívanýmlevetiracetamemneovlivňujesérovékoncentracesouběžněpodávaného

karbamazepinu a valproátu vustáleném stavu.

Datanaznačují,žeantiepileptikaindukujícíenzymyzvyšujíclearancelevetiracetamuudětío20

%. Dávku však není třeba upravovat.

Probenecid

Probenecid(500mg4xdenně),blokátorrenálnítubulárnísekrece,vykázalinhibicirenální

clearanceprimárního metabolitu, alenelevetiracetamu.Koncentraceuvedenéhometabolitu však

zůstává nízká. Lze očekávat, že ostatní léčiva vylučovaná aktivní tubulární sekrecí by také mohla

snižovatrenálníclearancimetabolitu.Účineklevetiracetamunaprobenecidnebylstudována

účineklevetiracetamunadalšíaktivněvylučovanéléčivélátkynapř.NSAIDs,sulfonamidya

methotrexát, není znám.

Perorální kontraceptiva a jiné farmakokinetické interakce

Levetiracetamvdávce1,000 mg denně neovlivnil farmakokinetiku orálních kontraceptiv (ethinyl-

estradiolalevonorgestrel);endokrinníparametry(luteinizačníhormonaprogesteron)se

nezměnily.Levetiracetamvdávce2,000mgdenněneovlivnilfarmakokinetikudigoxinua

warfarinu;protrombinovýčassenezměnil.Současnépodávánídigoxinu,orálníchkontraceptiva

warfarinu neovlivnilo farmakokinetiku levetiracetamu.

Antacida

Nejsou k dispozici žádné údaje o vlivu antacid na vstřebávání levetiracetamu.

Jídlo a alkohol

Rozsahvstřebávánílevetiracetamunebyljídlemovlivněn,alerychlostvstřebávánísemírně

snížila. Nejsou kdispozici žádné údaje o interakci levetiracetamu s alkoholem.

4.6 Fertilita, těhotenství a kojení

Těhotenství

Dostatečnéúdajeopodávánílevetiracetamutěhotnýmženámnejsoukdispozici.Studiena

zvířatech prokázaly reprodukční toxicitu (viz bod 5.3). Potenciální riziko pro člověka není známé.

Podávánílevetiracetamusevtěhotenstvíauženvreprodukčnímvěku,kterénepoužívají

antikoncepci, nedoporučuje, pokud to není nezbytně nutné.

Fyziologické změny během gravidity mohou stejně jako u jiných antiepileptiky ovlivnit

koncentraci levetiracetamu. Během gravidity byly zaznamenány případy snížené koncentrace

levetiracetamu vplasmě. Kvýraznějšímu poklesu docházelo během třetího trimestru gravidity

(až60 % snížení oproti výchozí koncentraci před začátkem gravidity).Vhodná klinická léčba

těhotných žen léčených levetiracetamem by proto měla být zajištěna. Vysazení antiepileptické

léčby může vést kexacerbaci onemocnění,cožmůže poškodit matku i plod.

Kojení

Levetiracetamjevylučovándomateřskéhomléka,protosekojenínedoporučuje.Pokudjevšak

léčba levetiracetamem během kojení nezbytná, je třeba vzhledem k významu kojení zvážit poměr

rizika a přínosu léčby.

Fertilita

Ve studiích na zvířatech nebyl zjištěn žádný účinek na fertilitu (viz bod 5.3).

Nejsou k dispozici žádné údaje z klinické praxe, potenciální riziko pro člověka není známo.

4.7 Účinky na schopnost řídit a obsluhovat stroje

Studie hodnotícíúčinky na schopnost řídit nebo obsluhovat stroje nebyly provedeny.

Vzhledemkmožnérozdílnéindividuálnícitlivostimohouněkteřípacientipociťovatospalost

nebojinépříznakysouvisejícíscentrálnímnervovýmsystémem,a tozejménanazačátkuléčby

nebopozvýšenídávky.Protoseutěchtopacientůdoporučujeopatrnostpřiprovádění

náročnějšíchaktivit,např.řízenívozidelneboobsluhovánístrojů.Pacientůmsenedoporučuje

říditneboobsluhovatstroje,dokudsenezjistí,žejejichschopnostvykonávattytočinnostinení

ovlivněna.

4.8 Nežádoucí účinky

Souhrn bezpečnostníhoprofilu

Souhrnnéúdajeobezpečnostizklinickýchstudiíprovedenýchudospělýchsparciálními

záchvatyléčenýchperorálnímilékovýmiformamiukázaly,žesenežádoucíúčinkyvyskytlyu

46,4%pacientůléčenýchlevetiracememau42,2%nemocných,jimžbylopodávánoplacebo.

Závažnénežádoucíúčinkysevyskytlyu2,4%pacientůveskupiněslevetiracememau2,0%

nemocnýchvplacebovéskupině.Nejčastějiuváděnýminežádoucímiúčinkybylyospalost,

astenieazávratě.Přianalýzesouhrnnýchbezpečnostníchdatnebylzjištěnžádnýjednoznačný

vztahkdávce,aleincidenceazávažnostnežádoucíchúčinkůsouvisejícíchscentrálním

nervovým systémem se časem snižovala.

Přimonoterapiiseu49,8%pacientůvyskytlynežádoucíúčinkyvsouvislosti

spodávanýmlékem.Nejčastějisevyskytujícíminežádoucímiúčinkybylyúnava

a ospalost.

Studie provedená u dospělých a dospívajících (12-65 let) s myoklonickými záchvaty ukázala, že u

33,3%pacientůveskupiněslevetiracememau30,0%pacientůveskupiněsplacebemse

vyskytlynežádoucíúčinkysouvisejícísléčbou.Nejčastějihlášenýminežádoucímiúčinkybyly

bolesti hlavy a somnolence.Incidencenežádoucích účinků u pacientů s myoklonickými záchvaty

bylanižší než u dospělých pacientů s parciálními záchvaty (33,3% proti 46,4%).

Studieprovedenáudospělýchadětí(4-65let)sidiopatickougeneralizovanouepilepsií

sprimárněgeneralizovanýmitonicko-klonickýmizáchvatyukázala,žeu39,2%pacientůve

skupiněslevetiracetamemau29,8%pacientůveskupiněsplacebemsevyskytlynežádoucí

účinky,kterébylyhodnocenyjakosouvisejícísléčbou.Nejčastějihlášenýmnežádoucím

účinkem byla únava.

Zvýšenífrekvencezáchvatůovícenež 25%bylohlášenou14%dospělýchadětských pacientů

(vevěku4-16let)sparciálnímizáchvatyléčenýchlevetiracetamemau26%dospělýcha21%

dětí, kterým bylo podávánoplacebo.

Připoužitílevetiracetamuvléčběprimárněgeneralizovanýchtonicko-klonickýchzáchvatůu

dospělýcha dospívajících s idiopatickou generalizovanou epilepsií nebyl pozorován žádný účinek

na frekvenci absencí.

Seznam nežádoucích účinků

Nežádoucí účinky hlášené z klinických studií (u dospělých, mladistvých, dětí i kojenců >1 měsíc)

a z postmarketingovýchzkušeností jsou uvedeny níže podle tříd orgánových systémů a podle

frekvence. Pro klinické studie je frekvence definována takto: velmi časté (≥1/10),časté (≥1/100

až <1/10), méně časté (≥1/1 000 až <1/100), vzácné (≥1/10 000 až<1/1 000), velmi vzácné

(<1/10000). Údaje získané po uvedení přípravku na trh nejsou dostatečné pro odhad frekvence

nežádoucích účinků v léčené populaci.

Infekce a zamoření

Časté: infekce, nasopharyngitis

Poruchykrve a lymfatického systému

Časté: trombocytopenie

Po uvedení natrh:leukopenie,neutropenie, pancytopenie(v některých případech popsána suprese

kostní dřeně).

Poruchymetabolismu a výživy

Časté: anorexie, přírůstek tělesné hmotnosti .

Riziko anorexie je vysoké v případě souběžného podávání topiramátu s levetiracetamem.

Po uvedení na trh: úbytek tělesné hmotnosti

Psychiatrické poruchy

Časté:agitovanost,deprese,emočnílabilita/výkyvynálady,hostilita/agresivita,nespavost,

nervozita/podrážděnost, poruchy osobnosti, abnormální myšlení

Pouvedenínatrh:abnormálníchování,zlost,úzkost,zmatenost,halucinace,psychotické

onemocnění, sebevražda, sebevražedný pokusasebevražedné představy

Poruchynervovéhosystému

Velmi časté : ospalost

Časté: amnézie, ataxie,křeče, závratě, bolesti hlavy, hyperkineze, třes, poruchy rovnováhy,

poruchy pozornosti, poruchy paměti.

Po uvedení na trh: parestézie

Poruchy oka

Časté: diplopie, rozostřené vidění

Poruchy uchaalabyrintu

Časté: vertigo

Respirační, hrudní a mediastinální poruchy

Časté: zhoršení kašle

Gastrointestinální poruchy

Časté: bolesti břicha, průjem, dyspepsie, nauzea, zvracení

Po uvedení na trh: pankreatitis

Poruchy jateražlučových cest

Po uvedení na trh: selhání jater, hepatitis, abnormální jaterní funkce

Poruchy kůže a podkožní tkáně

Časté: vyrážka, ekzém, svědění

Po uvedení na trh: alopecie–v některých případech bylapovysazenílevetiracetamupozorována

obnova kštice.

Poruchy svalové a kosterní soustavy a pojivové tkáně

Časté: myalgie

Celkové poruchy a reakce v místě aplikace

Velmi časté: astenie/únava.

Poranění, otravy a procedurální komplikace

Časté: náhodné poranění

Popis vybraných nežádoucích účinků

Riziko anorexie je vyšší při současném podávání levetiracetamu a topimarátu.

V některých případechalopeciebylapo vysazení levetiracetamupozorována obnova kštice.

Pediatrická populace

Studie provedená u dětských pacientů (4-16 let) s parciálními záchvaty ukázala, že u 55,4%

pacientů ve skupině léčené leviracetamem a u 40,2% pacientů ve skupině s placebem se vyskytly

nežádoucí účinky. Závažné nežádoucí účinky se vyskytly u 0,0% pacientů ve skupině léčené

leviracetamem a u 1,0% pacientů ve skupině léčené placebem. Nejčastěji hlášenými nežádoucími

účinky u dětských pacientů byly somnolence, hostilita, nervozita, emoční labilita, agitovanost,

anorexie, astenie a bolesti hlavy. Výsledky bezpečnosti u dětských pacientů byly konzistentní s

bezpečnostním profilem levetiracetamu u dospělých, s výjimkou behaviorálních a

psychiatrických nežádoucích účinků, které byly častější u dětí nežu dospělých (38,6% proti

18,6%). Relativní riziko však bylo u dětí ve srovnání s dospělými podobné.

Studie provedená u dětí (ve věku 1 měsíc až méně než 4 roky) sparciálními záchvaty ukázala, že

u 21,7% pacientů ve skupině léčené leviracetamem a 7,1% pacientů ve skupině léčené placebem

se vyskytly nežádoucí účinky. Žádné závažné nežádoucí účinky u pacientů se neobjevily ani ve

skupině léčené leviracetamem ani ve skupině léčené placebem. Během dlouhodobé pokračovací

studie N01148 ve věkové skupině 1 měsíc až < 4 roky byly nejčastějšími s lékem spojenými

nežádoucími účinky, které se projevily v průběhu léčby, podrážděnost (7,9%), konvulze (7,2%),

somnolence (6,6%), psychomotorická hyperaktivita (3,3%), poruchy spánku (3,3%) a agresivita

(3,3%). Výsledky týkající se bezpečnosti u dětských pacientů byly v souladu s bezpečnostním

profilemlevetiracetamu u starších dětí ve věku 4-16 let.

Dvojitě zaslepená placebem kontrolovaná bezpečnostní pediatrická studie s uspořádáním pro

hodnocenínon-inferioritysledovala kognitivní a neuro-psychologické účinky levetiracetamu u 4-

16letých dětí trpících parciálními záchvaty. Ze studie vyplývá, že v populaci splňující podmínky

protokolu („per-protocol“populace) se levetiracetam neodlišoval (nebyl horší) od placebas

ohledem na změnu od výchozího stavu ve složeném skóre k hodnocení paměti Leiter-R

zahrnujícím pozornost a paměť (Leiter-R Attention and Memory, Memory Screen Composite

score). Výsledky týkající se chování a emočního fungování naznačovaly u pacientů léčených

levetiracetamem zhoršení, pokud jde o agresivní chování, což bylo měřeno standardizovaným a

systematickým způsobem za použití ověřeného nástroje (CBCL–Achenbach Child Behaviour

Checklist). Avšak u jedinců, kteří užívali levetiracetam v dlouhodobé otevřené následné studii,

nedošlo v průměru ke zhoršení chování a emočního fungování; zejména měřítka agresivního

chování nebyla horší oproti výchozímu stavu.

4.9 Předávkování

Symptomy

Při předávkování levetiracetamem byla pozorována somnolence, agitovanost, agresivita, poruchy

vědomí, respirační útlum a kóma.

Léčba předávkování

Po akutním předávkování je třeba žaludek vyprázdnit výplachem nebo vyvoláním zvracení.

Žádné specifické antidotum levetiracetamu není k dispozici. Léčba předávkování je

symptomatická a může zahrnovat i hemodialýzu. Účinnost vylučování levetiracetamu dialýzou je

60% a primárního metabolitu 74%.

5. FARMAKOLOGICKÉVLASTNOSTI

5.1 Farmakodynamické vlastnosti

Farmakoterapeutická skupina:

antiepileptika, jiná antiepileptika,ATC kód: N03AX14

Léčivá látka levetiracetam je pyrrolidonový derivát (S-enantiomer α-etyl-2-oxo-1-pyrrolidin

acetamid), chemicky nesouvisející sléčivými látkami obsaženými vsoučasných antiepileptických

přípravcích.

Mechanismus účinku

Mechanismus účinku levetiracetamu stále ještě není plně objasněn, zdá se však, že je odlišný od

ostatních v současnosti užívaných antiepileptik. Pokusyinvitroainvivonasvědčují tomu, že

levetiracetam nemění ani základní charakteristiky buněk ani normální přenos nervových vzruchů.

In vitrostudie ukazují, že levetiracetam ovlivňuje hladinu Ca2+ v neuronech částečnouinhibicí

kalciových kanálů typu N a snížením uvolňování Ca2+ z intraneuronálních zásob. Levetiracetam

navícčástečně antagonizuje snížení aktivity GABA-a glycinových kanálů způsobené zinkem a

betakarboliny. Mimoto se levetiracetam vin vitrostudiích váže na specifické vazebné místo v

mozkové tkáni hlodavců. Specifickým vazebným místem je synaptický vezikulární protein 2A,

který je považovánza součást procesů fúze vezikulů a exocytózy neurotransmiterů.

Levetiracetam a jeho analogy mají různou afinitu k vazbě na synaptický vezikulární protein 2A.

Afinita k vazbě na synaptický vezikulární protein 2A koreluje s jejich potencí k zábraně vzniku

záchvatů v audiogenních modelech epilepsie u myší. Uvedené nálezy naznačují, že interakce

mezi levetiracetamem a synaptickým vezikulárním proteinem 2A by mohla přispívat k jeho

antiepileptickému účinku.

Farmakodynamické účinky

Levetiracetam poskytuje ochranu před záchvaty u velkého počtu zvířecích modelů parciálních a

primárně generalizovaných záchvatů, aniž by měl pro-konvulsivní účinky. Primární metabolit je

neaktivní. U lidí potvrdila aktivita při parciální i generalizované epilepsii (epileptiformní

výboj/fotoparoxysmální odpověď) široké spektrum preklinicky stanoveného farmakologického

profilu levetiracetamu.

Klinické zkušenosti

Přídatná léčbaparciálních záchvatů s nebobez sekundární generalizace u dospělých,

mladistvých, dětía kojencůod 1 měsíce s epilepsií:

Účinnost levetiracetamu u dospělých byla prokázána ve 3 dvojitě zaslepených placebem

kontrolovaných studiích v denní dávce 1 000 mg, 2 000 mg nebo 3 000 mg rozdělené do dvou

dílčích dávek. Léčba trvala až 18 týdnů. V analýze sdružených dat bylo procento pacientů, kteří

dosáhli snížení frekvence parciálních záchvatů za týden o 50% a více proti počátečnímu stavu při

stabilní dávce (12/14 týdnů) 27,7%, 31,6% a 41,3% u pacientů s 1 000 mg, 2 000 mg resp. 3 000

mg levetiracetamu a 12,6% u placeba.

Pediatrická populace

U dětí (4-16 let) byla účinnost levetiracetamu prokázána ve dvojitě zaslepené placebem

kontrolované studii, do které bylo zařazeno 198 pacientů s trváním léčby 14 týdnů. V této studii

byl levetiracetam užíván ve fixní dávce 60 mg/kg/den rozdělené do dvou dílčích dávek. 44,6%

pacientů léčených levetiracetamem a 19,6% pacientů s placebem dosáhlo snížení frekvence

parciálních záchvatů za týden proti počátečnímu stavu o 50% a více. Při pokračující dlouhodobé

léčbě bylo 11,4% pacientů bez záchvatů po dobu alespoň 6 měsíců a 7,2% pacientů bylo bez

záchvatůpo dobu alespoň 1 roku.

U dětí (ve věku 1 měsíc ažméně než4 roky) byla účinnost levetiracetamu stanovena ve dvojitě

zaslepené placebem kontrolované studii, která zahrnovala 116pacientů a léčba trvala 5 dní. V

této studii dostávali pacienti denní dávku 20 mg/kg, 25 mg/kg, 40 mg/kg nebo 50 mg/kg

perorálního roztoku na základě titračního rozpisu podle věku. V této studii byla použita dávka 20

mg/kg/den titrovaná do 40 mg/kg/den pro kojence ve věku jeden měsíc až méně než 6 měsíců, a

dávka 25 mg/kg/den titrovanádo 50 mg/kg/den pro děti ve věku 6 měsíců ažméně než4roky.

Celková denní dávkabyla podávána rozděleně ve dvou dílčích dávkách.

Primárním měřítkem účinnosti byl podíl pacientů odpovídajících na léčbu (frekvence

respondentů, tj. procento pacientů s≥50% poklesem průměrné denní frekvence parciálních

záchvatů od výchozího stavu), který byl hodnocen zaslepeně centrálním hodnotitelem

prostřednictvím 48hodinového video EEG záznamu. Do analýzy účinnosti bylo zahrnuto109

pacientů, kteří měli nejméně 24 hodin videoEEG záznamu v obou obdobích, výchozím i

hodnoceném. 43,6% pacientů léčených levetiracetamem a 19,6% pacientů léčených placebem

bylo považováno zarespondéry. Výsledky se shodují napříč věkovými skupinami. S pokračující

dlouhodobou léčbou bylo 8,6% pacientů bez záchvatů nejméně po dobu 6 měsíců a7,8% bylo

bez záchvatů nejméně 1 rok.

Monoterapiepři léčbě parciálních záchvatů s nebo bez sekundární generalizace u pacientů od 16

let s nově diagnostikovanou epilepsií.

Účinnost levetiracetamu v monoterapii byla prokázána ve dvojitě zaslepeném paralelním

porovnánínon-inferioritys karbamazepinem s řízeným uvolňováním (CR) u 576 pacientůod 16

let věkus nově nebo nedávno diagnostikovanou epilepsií. U pacientů musely být přítomny pouze

spontánní parciální záchvaty nebo generalizované tonicko-klonickézáchvaty. Pacienti byli

randomizováni k užívání karbamazepinu CR v dávce 400-1200 mg/den nebo levetiracetamu v

dávce 1000-3 000 mg/den po dobu až 121 týdnů v závislosti na terapeutické odpovědi. Bez

záchvatůpo dobu 6 měsíců bylo 73,0% pacientů s levetiracetamem a 72,8% pacientů s

karbamazepinem CR; korigovaný absolutní rozdíl mezi léčbami byl 0,2% (95% CI:-7,8 8,2).

Více než polovina pacientů byla bez záchvatůpo dobu 12 měsíců (56,6% a 58,5% pacientů s

levetiracetamem resp. karbamazepinemCR).

Ve studii odrážející klinickou praxi mohla být vysazena souběžná antiepileptická léčba u části

pacientů, kteří reagovali na přídatnou léčbu levetiracetamem (36 dospělých pacientů z 69).

Přídatná léčba myoklonických záchvatů u juvenilní myoklonickéepilepsie udospělých a

mladistvých od 12 let.

Účinnost levetiracetamu byla prokázána ve dvojitě zaslepené placebem kontrolované studii

trvající 16 týdnů u pacientů od 12 let s idiopatickou generalizovanou epilepsií s myoklonickými

záchvaty u různých syndromů. Většina pacientů trpěla juvenilní myoklonickou epilepsií. V této

studii byl levetiracetam užíván v dávce 3 000 mg/den rozdělené do dvou denních dávek. 58,3%

pacientů léčených levetiracetamem a 23,3% pacientů s placebem dosáhlo snížení počtu dnůs

myoklonickým záchvatem za týden alespoň o50%. Při pokračující dlouhodobé léčbě bylo 28,6%

pacientů bez myoklonických záchvatů po dobu alespoň 6 měsíců a 21,0% pacientů bylo bez

myoklonických záchvatů po dobu alespoň 1 roku.

Přídatná léčbaprimárně generalizovaných tonicko-klonických záchvatů u dospělých mladistvých

od 12 let s idiopatickou generalizovanou epilepsií.

Účinnost levetiracetamu byla prokázána ve dvojitě zaslepené placebem kontrolované studii

trvající 24 týdnů, která zahrnovala dospělé, mladistvé a omezenýpočet dětí trpících idiopatickou

generalizovanou epilepsií sprimárně generalizovanými tonicko klonickými záchvaty (PGTC) u

různých syndromů (juvenilní myoklonická epilepsie, juvenilní epilepsie s absencemi, dětská

epilepsie s absencemi nebo epilepsie sGrand Mal záchvaty po probuzení).

V této studii byl levetiracetam užíván v dávce 3 000 mg/den u dospělých a mladistvých nebo 60

mg/kg/den u dětí rozdělené do dvou denních dávek.

72,2% pacientů léčených levetiracetamem a 45,2% pacientů s placebem dosáhlo snížení

frekvence primárně generalizovaných tonicko-klonických záchvatů za týden o 50% a více. Při

pokračující dlouhodobé léčběbylo 47,4%pacientů bez tonicko-klonických záchvatůpo dobu

alespoň 6 měsíců a 31,5% pacientů bylo bez tonicko-klonických záchvatů po dobualespoň1

roku.

5.2 Farmakokinetické vlastnosti

Levetiracetam je vysoce rozpustná látka s vysokou schopnostíprůniku. Farmakokinetický profil

je lineární s nízkou intra-ainter-individuální variabilitou. Při opakovaném podávání nedochází

ke změně clearance. K dispozici nejsou žádné důkazy o větší variabilitě mezi pohlavími, rasami

ani cirkadiánní variabilitě. Farmakokinetický profil u zdravých dobrovolníků a pacientů s

epilepsií je srovnatelný.

Vzhledem k úplnému a lineárnímu vstřebávání lze plazmatické hladiny předvídat na základě

perorální dávky levetiracetamu, vyjádřené v mg/kg tělesné hmotnosti. Plazmatické hladiny

levetiracetamu tedy není nutno monitorovat.

Byla prokázána významná korelace mezi plazmatickou koncentrací a koncentrací ve slinách u

dospělých a u dětí (poměr koncentrace ve slinách/ koncentrace v plazmě se pohybují v rozmezí 1-

1,7 pro tablety a 4 hodiny po podáníi properorální roztok).

Dospělí a mladiství

Vstřebávání

Levetiracetam se po perorálním podání rychle vstřebává. Absolutní biologická dostupnost po

perorálním podání se blíží 100%.

Maximální plazmatické koncentrace (C

) jsou dosaženy 1,3 hodiny po podání dávky.

Ustáleného stavu se dosahuje po dvou dnech při dávkovacím režimu dvakrát denně.

Maximálních koncentrací (C

) ve výši 31 µg/ml se běžně dosahuje po jednorázové dávce 1 000

mg a 43 µg/ml po opakované dávce 1 000 mg dvakrát denně.

Rozsah vstřebávání nezávisí na dávce a není ovlivněn příjmem potravy.

Distribuce

Žádné údaje o distribuci v tkáních u člověka nejsou k dispozici.

Ani levetiracetam ani jeho primární metabolit se ve významné míře neváží na bílkoviny krevní

plazmy (<10%). Distribuční objem levetiracetamu je přibližně 0,5-0,7 l/kg, což je hodnota blízká

celkovému objemu vody v organismu.

Biotransformace

Levetiracetam není v lidském organismu výrazně metabolizován. Hlavní metabolickou cestou

(24% dávky) je enzymatická hydrolýza acetamidové skupiny. Izoenzymy jaterního cytochromu

P450 nepodporují vznik primárního metabolitu ucb L057. Hydrolýza acetamidovéskupiny byla

zjištěna v řadě různých tkání včetně krvinek. Metabolit ucb L057 je farmakologicky neaktivní.

Byly zjištěny i dva méně významné metabolity. Jeden byl získán hydroxylací pyrrolidonového

jádra (1,6% dávky) a druhý otevřením pyrrolidonového kruhu (0,9% dávky). Další

neidentifikované složky představovaly pouze 0,6% dávky.

In vivonebyla zjištěna žádná enantiomerová interkonverze u levetiracetamu ani u jeho primárního

metabolitu.

In vitrobylo zjištěno, že levetiracetam a jeho primární metabolitneinhibují hlavní izoformy

jaterního cytochromu P450 u člověka (CYP34A, 2A6, 2C9, 2C19,2D6, 2E1 a1A2), aktivitu

glukuronyltransferázy (UGT1A1 a UGT1A6) ani epoxidové hydroxylázy. Levetiracetamin vitro

navíc neovlivňuje glukuronidaci kyseliny valproové.

V kulturách lidských hepatocytů měl levetiracetam minimální nebo žádný účinek na CYP1A2,

SULT1E1 nebo UGT1A1. Levetiracetam způsoboval mírnou indukci CYP2B6 a CYP3A4.In

vitroainvivo údaje o interakci s perorálními kontraceptivy, digoxinem a warfarinemneukazují,

že byin vivodocházelo k významné indukci enzymů. Proto je interakce levetiracetamu s jinými

látkami nepravděpodobná.

Vylučování

Plazmatický poločas u dospělých byl 7±1 hodin a nelišil se podle dávky, způsobu podání ani při

opakované aplikaci. Průměrná celková systémová clearance byla 0,96 ml/min/kg.

Hlavní cestou exkrece byla moč, kterou se vylučovalo průměrně 95% dávky (přibližně 93%

dávky se vyloučilo do 48 hodin). Stolicí se vyloučilo pouze 0,3% dávky.

Kumulativní vylučování levetiracetamu močí během prvních 48 hodin dosáhlo 66% dávky; v

případě jeho primárního metabolitu 24% dávky.

Renální clearance levetiracetamu je 0,6 ml/min/kg, pro ucb L057 4,2 ml/min/kg, což ukazuje, že

levetiracetam se vylučuje glomerulární filtrací s následnou tubulární reabsorpcí a že primární

metabolit se kromě glomerulární filtrace vylučuje i aktivní tubulární sekrecí.

Vylučování levetiracetamu koreluje s clearance kreatininu.

Starší pacienti

U starších pacientů je eliminační poločas prodlouženýpřibližně o 40% (10 až 11 hodin). To

souvisí se snížením renálních funkcí u této populace (viz bod 4.2).

Porucha renálních funkcí

Zdánlivá systémová clearance levetiracetamu a jeho primárního metabolitu koreluje sclearance

kreatininu. Proto se u nemocných se střednězávažnouazávažnou renální poruchou doporučuje

upravit udržovací denní dávku přípravku Levetiracetam podle clearance kreatininu (viz bod 4.2).

U anurických dospělých jedinců s terminálním renálním selháním byl poločas mezi dialýzami

přibližně 25 hodin aběhem dialýzy přibližně 3,1 hodin. Frakční vylučování levetiracetamu během

typické 4hodinové dialýzy činilo 51%.

Porucha funkce jater

U jedinců s mírnou a středně závažnou poruchou funkce jater nedocházelo k žádné významné

změně clearance levetiracetamu. U většiny jedinců se závažnou poruchou funkce jater byla

clearance levetiracetamu snížena o více než 50% v důsledku současnéporuchy renální funkce

(viz bod 4.2).

Pediatrická populace

Děti (4 až 12 let)

Po perorálním podání jedné dávky (20 mg/kg) dětems epilepsií (6-12 let) byl poločas

levetiracetamu 6,0 hodin. Zdánlivá systémová clearance byla přibližně o 30% vyšší než u

dospělých s epilepsií.

Po podání opakovaných dávek (20-60 mg/kg/den) dětem s epilepsií (4-12 let) byl levetiracetam

rychle absorbován. Maximální plazmatické koncentrace bylo dosaženo 0,5 až 1,0 hodinu po

podání. Bylo pozorováno lineární a dávce úměrné zvýšení maximální plazmatické koncentrace a

plochy pod křivkou. Eliminační poločas byl přibližně 5 hodin. Zdánlivá tělesná clearance byla1,1

ml/min/kg.

Kojenci a děti (1 měsíc až 4 roky)

Po jednorázovém podání (20 mg/kg) perorálního roztoku 100 mg/ml dětem s epilepsií

(1 měsíc–4 roky) byl levetiracetam rychle absorbován a maximální plazmatická koncentrace

byla pozorována přibližně 1 hodinu po podání. Farmakokinetické výsledky ukazují, že eliminační

poločas je u dětí kratší (5,3hodiny) než u dospělých (7,2 hodiny), a že zdánlivá tělesná clearance

je u dětí rychlejší (1,5 ml/min/kg) než u dospělých (0,96 ml/min/kg).

V analýze populační farmakokinetiky provedené u pacientů ve věku od 1 měsíce do 16 let

korelovala tělesná hmotnost významně se zdánlivou clearance (clearance narůstala se zvýšením

tělesné hmotnosti), a se zdánlivým distribučním objemem. Na obaparametry měl vliv také věk.

Tento účinek byl výraznější u mladších dětí, ustupoval se zvyšujícím se věkem a kolem 4 let věku

se stal zanedbatelným.

V obou analýzách populační farmakokinetiky došlo k asi 20% zvýšení zdánlivé clearance

levetiracetamu, když byl levetiracetam podáván spolus antiepileptiky, které indukují tvorbu

enzymů.

5.3 Předklinické údaje vztahující se k bezpečnosti

Neklinické údaje získané na základě konvenčních farmakologických studií bezpečnosti,

genotoxicity a kancerogenity nenaznačují žádné zvláštní riziko pro člověka.

Nežádoucí účinky, které nebyly pozorovány v klinických studiích, ale byly zjištěny u potkanů a v

menší míře u myší, při expozici podobným hladinám jako u člověka a s potenciálním významem

pro použití v klinické praxi, byly jaterní změny naznačující adaptivní odpověď, jako je zvýšená

hmotnost a centrilobulární hypertrofie, infiltrace tuku a zvýšená hladina jaterních enzymů v

plazmě.

U potkanů nebyly v dávkách až1800 mg/kg/den (6ti-násobek maximální doporučené denní dávky

u lidí v přepočtu na mg/m² nebo expozici) pozorovány žádné nežádoucí účinky na fertilitu samců

ani samic u rodičů a první generace potomků (F1).

Dvě studie embryo-fetálního vývoje (EFV studie) byly provedeny u potkanů s dávkami 400, 1

200 a 3 600 mg/kg/den. Při dávce 3 600 mg/kg/den došlo pouze v jedné z těchto EFV studií k

nepatrnému snížení fetální hmotnosti, spojenému s hraničním nárůstem počtu kostních

variant/menších anomálií. Nedošlo k žádnému ovlivnění embryo-mortality ani ke zvýšení

výskytu malformací. NOAEL (hladina bez pozorovaných nežádoucích účinků) byla 3 600

mg/kg/den pro březí samice potkanů (12ti-násobek maximální doporučené denní dávky u lidí na

při přepočtu na mg/m²) a 1 200 mg/kg/den pro plody.

Čtyři studie embryo-fetálního vývoje byly provedeny u králíků s dávkami 200, 600, 800, 1200 a

1 800 mg/kg/den. Dávka 1 800 mg/kg/den vedla ke značné toxicitě u samic-matek a ke snížení

fetální hmotnosti, spojené se zvýšeným výskytem plodů s kardiovaskulárními/kosterními

anomáliemi. NOAEL byla < 200 mg/kg/den pro samice-matky a200 mg/kg/den pro plody

(odpovídá maximální doporučené denní dávce u lidí při přepočtu na mg/m²).

Studie perinatálního a postnatálního vývoje byla provedena u potkanů s dávkami levetiracetamu

70, 350 a 1800 mg/kg/den. NOAEL byla≥1 800 mg/kg/den pro samice F0, stejně jako pro

přežití, růst a vývoj mláďat vrhu F1až do odstavení (6ti-násobek maximální doporučené denní

dávky u lidí při přepočtu na mg/m²).

Studie s novorozenci a mláďaty zvířat neukázaly u psů ani u potkanů žádné nežádoucí účinky na

standardní výsledky vývoje a maturace v dávkách do 1 800 mg/kg/den (6ti až17ti-násobek

maximální doporučené denní dávky u lidí při přepočtu na mg/m²).

6 FARMACEUTICKÉ ÚDAJE

6.1 Seznam pomocných látek

Jádro tablety

Koloidní bezvodý oxid křemičitý

Hyprolosa

Mikrokrystalickácelulosa

Magnesium-stearát

Potah tablety:Opadry II modrý (85F20694):

Polyvinylalkohol

Makrogol (PEG 3350)

Mastek

Oxid titaničitý (E171)

Indigokarmin (E132)

<500 mg>

0padry II žlutý (85F32004):

Polyvinylalkohol

Makrogol (PEG 3350)

Mastek

Oxid titaničitý (E171)

Žlutý oxid železitý (E172)

<750 mg>

Opadry II oranžový (85F23452):

Polyvinylalkohol

Makrogol (PEG 3350)

Mastek

Oxid titaničitý (E171)

Červený oxid železitý (E172)

Oranžová žluť (E110)

<1000 mg>

Opadry IIbílý(85F18422):

Polyvinylalkohol

Makrogol (PEG 3350)

Mastek

Oxid titaničitý (E171)

6.2 Inkompatibility

Neuplatňuje se.

6.3 Doba použitelnosti

30 měsíců

6.4 Zvláštní opatření pro uchovávání

Tento léčivý přípravek nevyžaduje žádné zvláštnípodmínky uchovávání.

6.5 Druhobalu a velikost balení

Levetiracetamtabletyjsoubalenydo PVC/Alblistrů(každý blistrobsahuje 10 tablet),kteréjsou

vloženy do papírových krabiček obsahujících 10, 20, 30, 50, 60, 100, 120 nebo 200 tablet.

Na trhu nemusí být všechny velikosti balení.

6.6 Zvláštní požadavky na likvidaci

Žádné zvláštní požadavky.

Všechen nepoužitýpřípravek nebo odpad musí být zlikvidován v souladu s místními požadavky.

7 DRŽITEL ROZHODNUTÍ OREGISTRACI

PharmaSwiss Česká republika s.r.o.

Jankovcova 1569/2c

17000 Praha 7

8 REGISTRAČNÍ ČÍSLA

Levetiracetam PharmaSwiss 250 mg: 21/732/11-C

Levetiracetam PharmaSwiss 500 mg: 21/733/11-C

Levetiracetam PharmaSwiss 750 mg: 21/734/11-C

Levetiracetam PharmaSwiss 1000 mg:21/735/11-C

9 DATUM PRVNÍREGISTRACE / PRODLOUŽENÍ REGISTRACE

16.11.2011

10 DATUM REVIZE TEXTU

16.11.2011

Podobné produkty

Vyhledávejte upozornění související s tímto produktem

Zobrazit historii dokumentů

Sdílejte tyto informace